Nematolebias whitei (Rio pearlfish): 119420029 Help Entry 119420029         CDS       T08042                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh04517   IgSF CAM signaling nwh04814   Motor proteins nwh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nwh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     119420029 (dynll2b)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     119420029 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119420029 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:nwh03037]     119420029 (dynll2b)    04812 Cytoskeleton proteins [BR:nwh04812]     119420029 (dynll2b) Cilium and associated proteins [BR:nwh03037]  Motile cilia and associated proteins   Dynein arm    119420029 (dynll2b) Cytoskeleton proteins [BR:nwh04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      119420029 (dynll2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RP853 Nop Motif Other DBs NCBI-GeneID:  119420029 NCBI-ProteinID:  XP_037543326 LinkDB All DBs Position 14:22055686..22057134 Genome browser AA seq 89 aa AA seqDB search MSDKKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgataagaaggcagtgatcaagaatgcagacatgtctgatgaaatgcagcaggat gcagtggactgtgccatgcaggccatggagaagtacaacatcgagaaggacatcgctgct tacgtcaaaaaggagtttgacaagaagtacaaccccacatggcactgcatcgtcgggagg aactttggcagctacgtgacgcatgaaaccaaacatttcatctacttctacctgggtcag gtggccattctcctgttcaagtccggctga

DBGET integrated database retrieval system