Nematolebias whitei (Rio pearlfish): 119420739 Help Entry 119420739         CDS       T08042                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh03082   ATP-dependent chromatin remodeling nwh04217   Necroptosis Brite KEGG Orthology (KO) [BR:nwh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     119420739  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     119420739  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nwh03036]     119420739   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nwh04147]     119420739 Chromosome and associated proteins [BR:nwh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119420739 Exosome [BR:nwh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119420739 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  119420739 NCBI-ProteinID:  XP_037544097 LinkDB All DBs Position 14:complement(15851406..15851705) Genome browser AA seq 99 aa AA seqDB search MIPQLQITNELKRRCCGCIPVYQAEVLEYLTAEILELVGKAARDYKKTGIIHRHLQLAVC NDEKLNKLLGGETITQGGVLPKIQVVLLPKKTEKSTKSK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgataccacagctccaaatcacaaacgagttaaaaaggaggtgctgtggatgtatcccc gtctatcaagcggaggtgcttgagtacttgaccgctgagatcctggagctggtgggaaaa gcggctcgtgattacaagaagaccgggatcatccaccgacacctgcagctggctgtctgc aatgacgagaagctcaacaagctgctgggaggagagaccatcactcagggaggagttcta cccaagattcaggtggtcctgctgcccaagaagaccgaaaaatccaccaagtccaagtag

DBGET integrated database retrieval system