Nematolebias whitei (Rio pearlfish): 119422156 Help Entry 119422156         CDS       T08042                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh04010   MAPK signaling pathway nwh04137   Mitophagy - animal nwh04140   Autophagy - animal nwh04218   Cellular senescence nwh04371   Apelin signaling pathway nwh04519   Cadherin signaling nwh04625   C-type lectin receptor signaling pathway nwh04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:nwh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119422156 (rras2)    04371 Apelin signaling pathway     119422156 (rras2)   09133 Signaling molecules and interaction    04519 Cadherin signaling     119422156 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     119422156 (rras2)    04137 Mitophagy - animal     119422156 (rras2)   09143 Cell growth and death    04218 Cellular senescence     119422156 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     119422156 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     119422156 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nwh04147]     119422156 (rras2)    04031 GTP-binding proteins [BR:nwh04031]     119422156 (rras2) Exosome [BR:nwh04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    119422156 (rras2)   Exosomal proteins of bladder cancer cells    119422156 (rras2) GTP-binding proteins [BR:nwh04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     119422156 (rras2) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SLFN-g3_helicase ATP_bind_1 RHG35-p190PhoGP_pG1 FeoB_N Motif Other DBs NCBI-GeneID:  119422156 NCBI-ProteinID:  XP_037545443 LinkDB All DBs Position 2:3317645..3362372 Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPMRKEKDKSGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctggctggaaggacggctcggtgcaggagaagtaccgtctggtcgtggtcggaggc ggaggggtcggaaaatcagccttgaccatccagttcattcagtcgtacttcgtcaccgac tatgaccccaccatcgaagactcttacaccaagcagtgtgtgatcgacgagcggccggcc aggctcgacatcctcgacacggctggacaggaagagtttggagccatgagagaacaatac atgaggaccggggagggcttcctgctcgtcttctcagtcactgacagaggaagctttgaa gaaatctataaattccaaaggcagattctccgagtcaaagacagagacgaattcccgatg atcctcgtaggaaacaaagcagatctggagctacagagacaagtaacccaggaggagggc cagcagctggccagacagttaaaggtcacctatatggaggcttcagccaaaattcgaatg aacgtagatcaagctttccacgagctggttagggtaatcaggaaattccaagagcaagaa tgtccaccttcaccagagcccatgagaaaagagaaggacaagagcggctgccattgtgtg atcgtctga

DBGET integrated database retrieval system