Nematolebias whitei (Rio pearlfish): 119422666 Help Entry 119422666         CDS       T08042                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh03030   DNA replication nwh03410   Base excision repair nwh03420   Nucleotide excision repair nwh03430   Mismatch repair nwh03440   Homologous recombination Brite KEGG Orthology (KO) [BR:nwh00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     119422666 (pold4)    03410 Base excision repair     119422666 (pold4)    03420 Nucleotide excision repair     119422666 (pold4)    03430 Mismatch repair     119422666 (pold4)    03440 Homologous recombination     119422666 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:nwh03032]     119422666 (pold4)    03400 DNA repair and recombination proteins [BR:nwh03400]     119422666 (pold4) DNA replication proteins [BR:nwh03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     119422666 (pold4) DNA repair and recombination proteins [BR:nwh03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       119422666 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      119422666 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  119422666 NCBI-ProteinID:  XP_037545981 LinkDB All DBs Position 16:2625451..2636858 Genome browser AA seq 107 aa AA seqDB search MTAKRGLITDSFNVVKKTRRGGKRTKSPTPPPCEREDEAKTVEEEELQKLKQFDLDWRFG PCSGISRLQRWERAKLHGLNPPEEIRELLQTHSDPEHSLSLWREYPF NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgacagccaagcgtggactgataactgattccttcaatgtggtgaagaaaacgaggaga ggaggaaaacggacgaagagccccacacctcctccatgtgagagagaggatgaagctaaa actgtggaagaggaagagctgcagaaactgaaacagtttgacctggactggaggtttggg ccctgctcaggcatcagccggctgcagaggtgggagcgagcaaagcttcatggactgaat ccacctgaggagatcagagagctgctgcaaacacactctgaccctgaacacagcctcagc ttgtggagggaatatcctttctga

DBGET integrated database retrieval system