Nematolebias whitei (Rio pearlfish): 119425009 Help Entry 119425009         CDS       T08042                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism nwh  Nematolebias whitei (Rio pearlfish) Pathway nwh03030   DNA replication nwh03082   ATP-dependent chromatin remodeling nwh03410   Base excision repair nwh03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:nwh00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     119425009 (pole3)    03410 Base excision repair     119425009 (pole3)    03420 Nucleotide excision repair     119425009 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     119425009 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:nwh03032]     119425009 (pole3)    03036 Chromosome and associated proteins [BR:nwh03036]     119425009 (pole3)    03400 DNA repair and recombination proteins [BR:nwh03400]     119425009 (pole3) Enzymes [BR:nwh01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      119425009 (pole3) DNA replication proteins [BR:nwh03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     119425009 (pole3) Chromosome and associated proteins [BR:nwh03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     119425009 (pole3) DNA repair and recombination proteins [BR:nwh03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       119425009 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C Adenylate_cycl SpoU_methylase CIS_TMP DUF4746 DUF5427 DMP19 RNA_pol_3_Rpc31 PBP_sp32 Motif Other DBs NCBI-GeneID:  119425009 NCBI-ProteinID:  XP_037548461 LinkDB All DBs Position 2:58418147..58434890 Genome browser AA seq 150 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVLAAMEEMEFQRFLEPLREALEVYKKDQKGKKEVSEQKRKDKEKKVDSESSK YREEEEADEEEEEEQQRMEEEPEEEEDVEN NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggcggagaggcccgaagatctgaaccttccgaatgcggtgatcacccgcatcatcaaa gaggcgctcccagatggggtgaacgtgtccaaagaagctcgcagagccatctcccaggca gccagcgtcttcgtgctgtatgccacctcctgtgcaaataactttgccatgaaggctaag aggaaaactctgaatgcaggagacgtgctggctgcaatggaggagatggagttccaacgc ttcctggagcctctcagagaagctctggaagtgtacaagaaggaccagaagggaaagaag gaggtttctgagcagaaacgcaaagataaagagaagaaggtcgactctgagagcagcaag tacagagaggaagaggaggctgatgaagaggaggaggaggagcagcagcgcatggaggag gagcctgaggaggaggaggacgtggagaactag

DBGET integrated database retrieval system