Nitrobacter winogradskyi: Nwi_0684 Help Entry Nwi_0684          CDS       T00276                                  Name (GenBank) ABC transporter, ATPase subunit   KO K15555   sulfonate transport system ATP-binding protein [EC:7.6.2.14] Organism nwi  Nitrobacter winogradskyi Pathway nwi00920   Sulfur metabolism nwi02010   ABC transporters Brite KEGG Orthology (KO) [BR:nwi00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     Nwi_0684  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     Nwi_0684  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:nwi02000]     Nwi_0684 Enzymes [BR:nwi01000]  7. Translocases   7.6  Catalysing the translocation of other compounds    7.6.2  Linked to the hydrolysis of a nucleoside triphosphate     7.6.2.14  ABC-type aliphatic sulfonate transporter      Nwi_0684 Transporters [BR:nwi02000]  ABC transporters, prokaryotic type   Mineral and organic ion transporters    Sulfonate transporter     Nwi_0684 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ABC_tran nSTAND1 AAA_22 AAA_21 AAA_16 AAA_25 AAA_23 RsgA_GTPase MMR_HSR1 SMC_N AAA_29 NB-ARC AAA_28 NACHT ATP-synt_ab Fn3-II_PB4 ATPase_2 DUF2244 AAA_5 AAA_18 nSTAND3 DUF87 MobB PRK Motif Other DBs NCBI-ProteinID:  ABA03950 UniProt:  Q3SUU1 LinkDB All DBs Position 763738..764193 Genome browser AA seq 151 aa AA seqDB search MLRGIDLHIPAGQFVAIVGRSGCGKSTLLRLIAGLETATAGSIGFGENIRAEDVRVMFQE PRLLPWTKVAANVEVGLGRERARHDARARAEQALTEVGLHDKRGQWPRILSGGQKQRVAL ARALVSRPRVLALDEPLGALDALTRIDAAPA NT seq 456 nt NT seq  +upstreamnt  +downstreamnt gtgctgcgcgggatcgatcttcatattccggcgggccagtttgtcgcgatcgtcgggcgc agcggttgcggcaagagcaccttgctgcggctgatcgccggtcttgagacggcaaccgca ggctcgatcggctttggtgaaaacatccgcgcggaagatgtccgcgtgatgttccaggaa ccgcgcttgctgccgtggacgaaggttgcggcaaacgtcgaggtcggcttgggtcgcgag cgcgcgcggcatgatgcgagggcacgcgccgagcaggcgttgaccgaggtcgggctgcac gacaaacgcgggcaatggcccaggatcctgtcgggcgggcagaagcagcgtgtcgcgctg gcccgcgccctggtcagccgtccgcgcgtgctggcgctcgacgagccgctcggtgcgctc gatgccttgacgcgcatcgatgcagcgcctgcttga

DBGET integrated database retrieval system