KEGG   Nitrospina watsonii: NSPWAT_0224
Entry
NSPWAT_0224       CDS       T08754                                 
Symbol
potA
Name
(GenBank) Spermidine/putrescine import ATP-binding protein PotA
  KO
K02052  putative spermidine/putrescine transport system ATP-binding protein
Organism
nwt  Nitrospina watsonii
Pathway
nwt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nwt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NSPWAT_0224 (potA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nwt02000]
    NSPWAT_0224 (potA)
Transporters [BR:nwt02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter
    NSPWAT_0224 (potA)
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 AAA_16 SMC_N AAA_23 ABC_ATPase Mg_chelatase ATP-synt_ab NACHT AAA_22 RsgA_GTPase AAA ORC-CDC6-like PduV-EutP AAA_29
Other DBs
NCBI-ProteinID: CAI2717083
UniProt: A0ABN8VYE1
LinkDB
Position
NSPWAT:238215..239309
AA seq 364 aa
MIRIEGLSKSFGGKPVLRDFSLEIGEGERFVLLGRSGCGKTTLLRCIAGFERPDAGSIFI
EGRAVNSLPVERRPIGFIFQRHALFPHKTVYDNIAVGPRIRGEAEQDIQDKIDALLAITR
LTGLRHAWPNQLSGGESQRVALARAVINRPKVLLLDEPLSALDASLRQNLRDELVEMQKA
FGITFLFVTHDQEEAMSLADRMSILEDGQLLQVGAPEQLYDRPADRFVAEFLGGVNRLPG
VVKSEAASGCRVTLDDSLQLLAGGELRFPVGTPVDVFFRPERAGLADEPGTRTGMNRVEG
VLEHKAFYGSHTRYRVRLLHGPAVTVQVRHGIDAGLRVGMRVWVEVAIEDTLLYQREKGN
ENDA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgatccgcattgaaggactgtccaaatcgttcggcggcaaacccgtgctccgcgacttt
tcgctggagatcggggaaggggagcgtttcgttttgctgggccgcagcgggtgcggcaaa
accacgttgctgcgctgcatcgccgggttcgagcgtcccgatgccggcagcattttcata
gaaggccgcgccgtcaacagcttgcctgtcgagcgccgtcccattggtttcatcttccaa
cgccacgccctgtttccgcacaagaccgtgtacgacaacatcgccgtcgggccgcgcatc
cgcggtgaagcggaacaggatattcaagacaagatcgacgcgctgctggcgatcacgcgc
ctgaccgggttgcgccatgcctggccgaaccagttgagcggcggcgaatcgcaacgtgtc
gccctggcgcgcgccgtcatcaatcggcccaaggtgctgttgctcgacgaacccctgtcg
gcgcttgacgccagcctgcgccagaatctgcgcgacgagttggtggagatgcagaaggcg
ttcggcattacgtttttattcgtcacccacgatcaggaagaagccatgagcctcgccgac
cgcatgagcattctggaagacgggcagttgttgcaggtgggcgcaccggaacagttgtac
gaccgtccggcggaccgcttcgttgccgaatttctgggcggggtcaatcgcctgcccggc
gtggtgaaaagcgaagccgcgtccggatgccgcgtgacgctggatgacagccttcagttg
ctggcgggaggcgaattgcgattcccggtgggaacgccggtcgatgtgttcttccgtccg
gaacgggccgggctggcagacgaacccggtacgcgcaccgggatgaaccgagtggaaggc
gtgctcgaacacaaagcgttttacggcagtcacacccggtaccgggtgcggttgctccac
ggcccggcggtgacggtacaggtgcggcacggcatcgatgccggtctgcgcgtcggcatg
cgggtgtgggtggaagttgcgatcgaagacaccttgctctaccagcgagagaaagggaat
gaaaacgatgcctga

DBGET integrated database retrieval system