Neisseria weixii: CGZ65_01065
Help
Entry
CGZ65_01065 CDS
T07968
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
nwx
Neisseria weixii
Pathway
nwx03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
nwx00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
CGZ65_01065
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
nwx03011
]
CGZ65_01065
Ribosome [BR:
nwx03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
CGZ65_01065
Bacteria
CGZ65_01065
Archaea
CGZ65_01065
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
mCpol
Motif
Other DBs
NCBI-ProteinID:
ATD64264
UniProt:
A0A3N4N7G9
LinkDB
All DBs
Position
192683..193036
Genome browser
AA seq
117 aa
AA seq
DB search
MNKHATRLRRARKTRARIADLKMVRLCVFRTNNHIYAQVISAEGDKVLAQASTLESEVRS
SLKSGSNVEAAALIGKRIAEKAKAAGVEKVAFDRSGFQYHGRVKALAEAARENGLSF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atgaataaacatgcaacccgactccgtcgtgcacgcaaaacccgtgcccgtatcgcggac
ttgaaaatggtaagattatgcgtgttccgcaccaataatcatatttatgctcaagtaatt
agtgctgaaggtgataaagtattggctcaagcctctaccttggaatctgaagtacgtagt
agcttaaaatcaggcagcaatgttgaagcagctgcattgattggcaaacgtattgcagaa
aaagcaaaagcagcaggtgtagagaaagttgcttttgaccgttccggtttccaatatcac
ggccgtgtaaaagcattagctgaagctgctcgtgaaaatggtttaagcttctaa
DBGET
integrated database retrieval system