Nocardia yamanashiensis: LTV02_00355 Help Entry LTV02_00355       CDS       T07935                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nya  Nocardia yamanashiensis Pathway nya00998   Biosynthesis of various antibiotics nya01100   Metabolic pathways nya01110   Biosynthesis of secondary metabolites Module nya_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:nya00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LTV02_00355    00074 Mycolic acid biosynthesis     LTV02_00355   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LTV02_00355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UGT41918 LinkDB All DBs Position 66303..66572 Genome browser AA seq 89 aa AA seqDB search MSIRQDIAEFLHTHYNLDLDSISPDATMQDIGLDSLGVLTIADLIETNYGISLDDERIAS VRTFAGLLDLIKLKLAEAAAAETQPAEGR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgatcaggcaagatatcgcagaatttctgcacacccattacaacctggatctcgac tcgatttcccccgatgccaccatgcaggacatcgggctcgattcgctcggggtcctgacc atcgcggatctcatcgagaccaactacggaatctccctggacgacgagcgaatcgcgtcc gtgcggaccttcgccggcctgctggatctcatcaagctcaagctggccgaggccgccgcg gccgagacccagcccgccgaaggccggtga

DBGET integrated database retrieval system