Nocardia yamanashiensis: LTV02_18450 Help Entry LTV02_18450       CDS       T07935                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nya  Nocardia yamanashiensis Pathway nya00998   Biosynthesis of various antibiotics nya01100   Metabolic pathways nya01110   Biosynthesis of secondary metabolites Module nya_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:nya00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LTV02_18450    00074 Mycolic acid biosynthesis     LTV02_18450   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LTV02_18450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UGT45242 LinkDB All DBs Position complement(3825198..3825437) Genome browser AA seq 79 aa AA seqDB search MAQRVREIVAAMAPQPVADMAGTDRLIEELGYDSLRLMELTVVLERSFELPRFKPEELMG VLRVDAVVDLVTRTLEVRA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gtggcgcagcgggttcgggagatcgtggcggcgatggcgccgcagccggtcgccgacatg gcgggcacggatcggctcatcgaggaactgggctacgactcgctgcggctgatggagctg accgtggtactggaacgttccttcgagctgccgcgattcaagccggaggagttgatgggg gtgctgcgggtcgatgccgtggtggacctcgtcacccggaccctggaggtgcgcgcgtga

DBGET integrated database retrieval system