Neisseria zalophi: D0T92_03050 Help Entry D0T92_03050       CDS       T06266                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nzl  Neisseria zalophi Pathway nzl01100   Metabolic pathways nzl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nzl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D0T92_03050    00074 Mycolic acid biosynthesis     D0T92_03050   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D0T92_03050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QEY25614 UniProt:  A0A5J6PTH8 LinkDB All DBs Position 666965..667201 Genome browser AA seq 78 aa AA seqDB search MSNIEQQVKKIVAEQLGVNEAEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEDA EKITTVQLAIDYIQSHSA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaacattgaacaacaagttaaaaaaattgttgccgaacaactgggcgttaacgaa gccgaagttaaaaacgaatcttcattccaagatgatttgggcgcagactctctggatacc gttgagttggtaatggctttggaagaagctttcggctgtgaaatccctgatgaggatgct gaaaaaatcactaccgtgcaattggctatcgactatatccaatcacactctgcctaa

DBGET integrated database retrieval system