Neisseria zoodegmatis: SAMEA4504057_1197 Help Entry SAMEA4504057_1197 CDS       T06683                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nzo  Neisseria zoodegmatis Pathway nzo01100   Metabolic pathways nzo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nzo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SAMEA4504057_1197 (acpP_2)    00074 Mycolic acid biosynthesis     SAMEA4504057_1197 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SAMEA4504057_1197 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 FitA-like_RHH Motif Other DBs NCBI-ProteinID:  SNU79694 UniProt:  A0A1X3CSX2 LinkDB All DBs Position 1:1303693..1303938 Genome browser AA seq 81 aa AA seqDB search MTEQEIRRILTDALVNLFEIEPERIKPETNLYEDLEIDSIDAIDLIDHIKRETGRKLKAE DFRNVRTVDDVVQAVSKIEAE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccgaacaagaaatccgccggattctgaccgatgctttggtgaatctgtttgaaatc gaacccgagcgcatcaagcccgaaaccaatctttatgaagatttggaaatcgacagtatc gacgccatcgacttgatcgaccacattaaacgcgaaaccggccgtaagctcaaagccgaa gatttccgcaacgtgcgcaccgtcgatgatgtggtgcaggccgtatcaaagattgaggcc gaataa

DBGET integrated database retrieval system