Neisseria zoodegmatis: SAMEA4504057_1259 Help Entry SAMEA4504057_1259 CDS       T06683                                  Symbol hfq Name (GenBank) regulator   KO K03666   host factor-I protein Organism nzo  Neisseria zoodegmatis Pathway nzo02024   Quorum sensing nzo03018   RNA degradation Brite KEGG Orthology (KO) [BR:nzo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     SAMEA4504057_1259 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     SAMEA4504057_1259 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:nzo03019]     SAMEA4504057_1259 (hfq)    03036 Chromosome and associated proteins [BR:nzo03036]     SAMEA4504057_1259 (hfq) Messenger RNA biogenesis [BR:nzo03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      SAMEA4504057_1259 (hfq) Chromosome and associated proteins [BR:nzo03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     SAMEA4504057_1259 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  SNU79753 UniProt:  A0A1X3CQ24 LinkDB All DBs Position 1:1364999..1365280 Genome browser AA seq 93 aa AA seqDB search MTAKGQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTSVTQMVYKHA ISTIVPARAVSLQHENKQPAAAPVQVETTQPSA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaccgctaaaggacaaatgttacaagatccttttttgaacgctttgcgtaaagagcat gtgcctgtttccatctacttggtaaacggcatcaagctgcaggggcaagttgaatcgttt gaccagtatgttgtattgctgcgtaatacatctgttacgcagatggtttacaaacatgcg atttccactatcgttccggctcgtgccgtgagcttgcagcatgaaaacaaacagcctgcc gctgcgccagttcaggttgaaaccacccagccttccgcctaa

DBGET integrated database retrieval system