Ornithorhynchus anatinus (platypus): 100074575 Help Entry 100074575         CDS       T01045                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04137   Mitophagy - animal oaa04140   Autophagy - animal oaa04142   Lysosome biogenesis oaa04144   Endocytosis oaa04145   Phagosome oaa04148   Efferocytosis oaa05132   Salmonella infection oaa05146   Amoebiasis oaa05152   Tuberculosis Brite KEGG Orthology (KO) [BR:oaa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100074575 (RAB7A)    04145 Phagosome     100074575 (RAB7A)    04142 Lysosome biogenesis     100074575 (RAB7A)    04140 Autophagy - animal     100074575 (RAB7A)    04137 Mitophagy - animal     100074575 (RAB7A)    04148 Efferocytosis     100074575 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100074575 (RAB7A)    05152 Tuberculosis     100074575 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100074575 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oaa04131]     100074575 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oaa04147]     100074575 (RAB7A)    04031 GTP-binding proteins [BR:oaa04031]     100074575 (RAB7A) Membrane trafficking [BR:oaa04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     100074575 (RAB7A) Exosome [BR:oaa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100074575 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    100074575 (RAB7A)   Exosomal proteins of colorectal cancer cells    100074575 (RAB7A)   Exosomal proteins of bladder cancer cells    100074575 (RAB7A) GTP-binding proteins [BR:oaa04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     100074575 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 G-alpha AAA_5 AAA_24 ATPase_2 NB-ARC AAA_14 NACHT SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  100074575 NCBI-ProteinID:  XP_028907314 Ensembl:  ENSOANG00000001856 UniProt:  F7F797 LinkDB All DBs Position X1:90012712..90067620 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctccagaaagaaagttttgctgaaagttatcatcctgggagattctggggtgggg aagacatcactcatgaaccagtatgtgaacaagaaattcagtaaccaatacaaggccaca ataggagcagacttcctgacgaaggaggtgatggtggatgacagactagttacgatgcag atctgggacacagcagggcaggaacggtttcagtcccttggtgtggccttctacagagga gcagattgctgcgttctggtctttgatgtgactgcccccaacacattcaaaaccctggac agctggagggatgaatttctcattcaagccagtcccagggatcctgaaaactttcccttc gtcgtgctgggaaacaagattgacctagaaaacagacaagttgccacaaaacgagcacag gcctggtgctacagcaaaaataacatcccctactttgagaccagtgccaaggaagccatc aatgtggaacaggctttccagacaattgcacgaaatgcacttaaacaggaaacagaggtg gagctgtacaacgaattccctgaacccatcaaactagacaagaacgaccgagcaaaggcc tctgcagagagctgcagctgctga

DBGET integrated database retrieval system