Ornithorhynchus anatinus (platypus): 100076202
Help
Entry
100076202 CDS
T01045
Symbol
TIMM17B
Name
(RefSeq) mitochondrial import inner membrane translocase subunit Tim17-B isoform X1
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
oaa
Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:
oaa00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
oaa03029
]
100076202 (TIMM17B)
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
oaa02000
]
100076202 (TIMM17B)
Mitochondrial biogenesis [BR:
oaa03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
100076202 (TIMM17B)
Transporters [BR:
oaa02000
]
Other transporters
Primary active transporters [TC:
3
]
100076202 (TIMM17B)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
100076202
NCBI-ProteinID:
XP_028923881
Ensembl:
ENSOANG00000014281
UniProt:
F6R1V0
LinkDB
All DBs
Position
6:21938927..21944147
Genome browser
AA seq
172 aa
AA seq
DB search
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGFRHRFWGSVSAVRSRAP
QIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLASRSGPLAMVGSAMMGG
ILLALIEGVGILLTRYTAQQFQNPAPFVEDPSQLPPKEGPAPTSYQGYGQYQ
NT seq
519 nt
NT seq
+upstream
nt +downstream
nt
atggaggaatacgctcgggagccctgcccatggcgcatcgtggacgactgcggtggagcc
ttcaccatgggcgtcatcggcggaggcgtattccaggcgattaagggctttcgcaatgct
ccagttggattccggcaccggttttggggaagtgtcagtgccgtgaggagccgggcgcca
cagatcggaggcagctttgccgtgtggggtggcttgttctccaccatcgactgtgggctg
gtgaggctgcggggtaaggaggatccctggaattccatcaccagcggagcgctcaccggt
gcggtgctggcttcccgcagtgggccgctggccatggtgggttctgctatgatgggtggc
atcttgttggccctgatcgagggcgtcggcatccttctcacccgctacacagctcagcag
ttccagaaccctgccccctttgtggaggaccccagccagttgccccccaaggagggccct
gctccaaccagttaccagggctatggacagtaccagtga
DBGET
integrated database retrieval system