KEGG   Ornithorhynchus anatinus (platypus): 100080691
Entry
100080691         CDS       T01045                                 
Name
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha isoform X1
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04015  Rap1 signaling pathway
oaa04020  Calcium signaling pathway
oaa04022  cGMP-PKG signaling pathway
oaa04062  Chemokine signaling pathway
oaa04071  Sphingolipid signaling pathway
oaa04081  Hormone signaling
oaa04082  Neuroactive ligand signaling
oaa04261  Adrenergic signaling in cardiomyocytes
oaa04270  Vascular smooth muscle contraction
oaa04371  Apelin signaling pathway
oaa04540  Gap junction
oaa04611  Platelet activation
oaa04713  Circadian entrainment
oaa04720  Long-term potentiation
oaa04723  Retrograde endocannabinoid signaling
oaa04724  Glutamatergic synapse
oaa04725  Cholinergic synapse
oaa04726  Serotonergic synapse
oaa04728  Dopaminergic synapse
oaa04730  Long-term depression
oaa04750  Inflammatory mediator regulation of TRP channels
oaa04911  Insulin secretion
oaa04912  GnRH signaling pathway
oaa04915  Estrogen signaling pathway
oaa04916  Melanogenesis
oaa04918  Thyroid hormone synthesis
oaa04921  Oxytocin signaling pathway
oaa04922  Glucagon signaling pathway
oaa04924  Renin secretion
oaa04925  Aldosterone synthesis and secretion
oaa04927  Cortisol synthesis and secretion
oaa04928  Parathyroid hormone synthesis, secretion and action
oaa04929  GnRH secretion
oaa04934  Cushing syndrome
oaa04935  Growth hormone synthesis, secretion and action
oaa04961  Endocrine and other factor-regulated calcium reabsorption
oaa04970  Salivary secretion
oaa04971  Gastric acid secretion
oaa04972  Pancreatic secretion
oaa05010  Alzheimer disease
oaa05016  Huntington disease
oaa05017  Spinocerebellar ataxia
oaa05022  Pathways of neurodegeneration - multiple diseases
oaa05135  Yersinia infection
oaa05142  Chagas disease
oaa05143  African trypanosomiasis
oaa05146  Amoebiasis
oaa05163  Human cytomegalovirus infection
oaa05170  Human immunodeficiency virus 1 infection
oaa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100080691
   04371 Apelin signaling pathway
    100080691
   04020 Calcium signaling pathway
    100080691
   04071 Sphingolipid signaling pathway
    100080691
   04022 cGMP-PKG signaling pathway
    100080691
  09133 Signaling molecules and interaction
   04082 Neuroactive ligand signaling
    100080691
   04081 Hormone signaling
    100080691
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100080691
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100080691
   04062 Chemokine signaling pathway
    100080691
  09152 Endocrine system
   04911 Insulin secretion
    100080691
   04922 Glucagon signaling pathway
    100080691
   04929 GnRH secretion
    100080691
   04912 GnRH signaling pathway
    100080691
   04915 Estrogen signaling pathway
    100080691
   04921 Oxytocin signaling pathway
    100080691
   04935 Growth hormone synthesis, secretion and action
    100080691
   04918 Thyroid hormone synthesis
    100080691
   04928 Parathyroid hormone synthesis, secretion and action
    100080691
   04916 Melanogenesis
    100080691
   04924 Renin secretion
    100080691
   04925 Aldosterone synthesis and secretion
    100080691
   04927 Cortisol synthesis and secretion
    100080691
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100080691
   04270 Vascular smooth muscle contraction
    100080691
  09154 Digestive system
   04970 Salivary secretion
    100080691
   04971 Gastric acid secretion
    100080691
   04972 Pancreatic secretion
    100080691
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100080691
  09156 Nervous system
   04724 Glutamatergic synapse
    100080691
   04725 Cholinergic synapse
    100080691
   04728 Dopaminergic synapse
    100080691
   04726 Serotonergic synapse
    100080691
   04720 Long-term potentiation
    100080691
   04730 Long-term depression
    100080691
   04723 Retrograde endocannabinoid signaling
    100080691
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100080691
  09159 Environmental adaptation
   04713 Circadian entrainment
    100080691
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100080691
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100080691
   05163 Human cytomegalovirus infection
    100080691
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100080691
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100080691
   05142 Chagas disease
    100080691
   05143 African trypanosomiasis
    100080691
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100080691
   05016 Huntington disease
    100080691
   05017 Spinocerebellar ataxia
    100080691
   05022 Pathways of neurodegeneration - multiple diseases
    100080691
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100080691
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oaa04147]
    100080691
   04031 GTP-binding proteins [BR:oaa04031]
    100080691
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100080691
GTP-binding proteins [BR:oaa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    100080691
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE AAA_29
Other DBs
NCBI-GeneID: 100080691
NCBI-ProteinID: XP_028911279
Ensembl: ENSOANG00000002649
UniProt: F7B6J3
LinkDB
Position
X5:complement(62979981..63298284)
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKFEHNKAQAQLVREVDVEK
VSAFENTYVEAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPTYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactttggagtccatcatggcgtgctgcctgagcgaggaagccaaggaagcccggcgc
atcaacgacgagatcgagcggcagctccgcagggacaagcgggatgcgcgccgggagctc
aagctgctgctgctcggaacaggagaaagtggcaaaagcacattcatcaaacaaatgagg
atcatccatggatcaggctattccgatgaagataaaaggggcttcacaaaactggtgtat
cagaacatatttacagccatgcaggccatgatcagagccatggatacactcaaaatccca
tacaagtttgaacacaataaggcccaggctcagttagttcgggaagttgatgtagagaag
gtgtctgctttcgagaacacctatgtggaagcaataaagagtttatggaatgatcctgga
atccaagagtgttatgacagacgacgagaatatcagctttcagactcaaccaagtactat
cttaatgacctggaccgtgtagcagatcctacctatctgcctactcaacaagatgtcctc
agagttcgagtgcccaccacagggatcattgagtatccatttgacttacaaagcgtcatt
ttcagaatggtggatgtagggggccaacgatcagaaaggagaaaatggatacactgcttt
gaaaatgtcacctccattatgtttctcgtagcccttagcgaatatgatcaagtgctcgtg
gagtcagacaatgagaatcgaatggaggaaagcaaagcgctgtttaggacaattatcaca
tacccctggttccagaactcttcagtgattctgttcttaaacaagaaggatcttctagag
gagaaaattatgtactcccatctagttgattatttcccagaatatgatggtccccagagg
gatgcacaagctgcccgagaattcatcctgaagatgttcgtcgacctgaatccagacagt
gacaaaatcatctactcccacttcacgtgcgccacagataccgaaaacatccgtttcgtc
tttgcagctgtcaaggacaccatccttcagttaaatctgaaggagtacaacctggtctaa

DBGET integrated database retrieval system