Ornithorhynchus anatinus (platypus): 100082482 Help Entry 100082482         CDS       T01045                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04072   Phospholipase D signaling pathway oaa04140   Autophagy - animal oaa04150   mTOR signaling pathway oaa04151   PI3K-Akt signaling pathway oaa04152   AMPK signaling pathway oaa04211   Longevity regulating pathway oaa04218   Cellular senescence oaa04714   Thermogenesis oaa04910   Insulin signaling pathway oaa04919   Thyroid hormone signaling pathway oaa05163   Human cytomegalovirus infection oaa05165   Human papillomavirus infection oaa05168   Herpes simplex virus 1 infection oaa05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     100082482 (RHEB)    04151 PI3K-Akt signaling pathway     100082482 (RHEB)    04152 AMPK signaling pathway     100082482 (RHEB)    04150 mTOR signaling pathway     100082482 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100082482 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     100082482 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     100082482 (RHEB)    04919 Thyroid hormone signaling pathway     100082482 (RHEB)   09149 Aging    04211 Longevity regulating pathway     100082482 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     100082482 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     100082482 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     100082482 (RHEB)    05163 Human cytomegalovirus infection     100082482 (RHEB)    05165 Human papillomavirus infection     100082482 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:oaa04031]     100082482 (RHEB) GTP-binding proteins [BR:oaa04031]  Small (monomeric) G-proteins   Ras Family    Rheb     100082482 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 Motif Other DBs NCBI-GeneID:  100082482 NCBI-ProteinID:  XP_028933656 Ensembl:  ENSOANG00000048639 UniProt:  A0A6I8NCC2 LinkDB All DBs Position 13:complement(3651707..3701896) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKIIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGSASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaaatcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcgttgacgattcagtttgtcgaaggccagtttgtggactcctacgatccaaccatagaa aacacatttacaaaactgatcacagtaaatggacaagaatatcaccttcagctagtagac acagctgggcaagatgaatactccatctttcctcagacgtactccatagacattaatggt tacattcttgtgtactcagttacatccatcaaaagctttgaagtgatcaaaattatccac ggcaagttgttggatatggtgggaaaagtccaaatacccatcatgttggttggaaataag aaggacttacacatggaaagggtgatcagttacgaagaagggaaggccctagcagaatcc tggaatgcagcatttttggaatcttctgcaaaagaaaatcagacagctgttgatgtgttc aggaggataattttggaggcagaaaaaatcgacgggtcagcttcacaagggaagtcttca tgctcagtaatgtaa

DBGET integrated database retrieval system