Ornithorhynchus anatinus (platypus): 100083806 Help Entry 100083806         CDS       T01045                                  Symbol MYL5 Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04360   Axon guidance oaa04510   Focal adhesion oaa04520   Adherens junction oaa04670   Leukocyte transendothelial migration oaa04810   Regulation of actin cytoskeleton oaa04814   Motor proteins oaa04820   Cytoskeleton in muscle cells oaa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oaa00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100083806 (MYL5)    04520 Adherens junction     100083806 (MYL5)   09142 Cell motility    04814 Motor proteins     100083806 (MYL5)    04820 Cytoskeleton in muscle cells     100083806 (MYL5)    04810 Regulation of actin cytoskeleton     100083806 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     100083806 (MYL5)   09158 Development and regeneration    04360 Axon guidance     100083806 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100083806 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oaa04812]     100083806 (MYL5) Cytoskeleton proteins [BR:oaa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      100083806 (MYL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF_EFCAB10_C EF-hand_9 AIF-1 Lipoprotein_6 Motif Other DBs NCBI-GeneID:  100083806 NCBI-ProteinID:  XP_039766599 Ensembl:  ENSOANG00000006516 UniProt:  F6YBH8 LinkDB All DBs Position X3:31429998..31446273 Genome browser AA seq 175 aa AA seqDB search MSMASRKPKKKEGGGVRTQKASSSVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDT YASLGKTNVKDDELDAMLKEATGPLNFTMFLNLFGEKLNGTDPEETILNAFKLLDPDGKG HINKDYIKRLLMSQADKMTAEEVDQMFQFAPIDVAGNLDYKALSYTITHGEEKEE NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgagcatggccagtagaaagcccaagaagaaggaaggaggtggtgtacgaacccagaaa gcttcatccagtgttttctccaactttgagcagacacagatccaagaattcaaggaagct ttcacattaatggaccagaacagagatggattcattgataaggaagacttgaaagacact tatgcctctctgggtaaaacaaacgttaaagatgatgaactggatgccatgcttaaagaa gccactggaccccttaatttcacaatgttcttgaacctatttggagaaaaattgaatggt actgaccctgaagagacaatattaaatgcatttaaattgcttgacccggatgggaaagga catatcaacaaggattatataaagcgtttgctgatgtcacaagcagacaagatgacggct gaagaggtagaccagatgttccagtttgcgcctatcgatgtcgccggcaatttggattac aaggctttgagctacactattacacacggggaggaaaaggaagaataa

DBGET integrated database retrieval system