Ornithorhynchus anatinus (platypus): 100085312
Help
Entry
100085312 CDS
T01045
Symbol
NDUFS1
Name
(RefSeq) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
KO
K03934
NADH dehydrogenase (ubiquinone) Fe-S protein 1 [EC:
7.1.1.2
]
Organism
oaa
Ornithorhynchus anatinus (platypus)
Pathway
oaa00190
Oxidative phosphorylation
oaa01100
Metabolic pathways
oaa04714
Thermogenesis
oaa04723
Retrograde endocannabinoid signaling
oaa04932
Non-alcoholic fatty liver disease
oaa05010
Alzheimer disease
oaa05012
Parkinson disease
oaa05014
Amyotrophic lateral sclerosis
oaa05016
Huntington disease
oaa05020
Prion disease
oaa05022
Pathways of neurodegeneration - multiple diseases
oaa05208
Chemical carcinogenesis - reactive oxygen species
oaa05415
Diabetic cardiomyopathy
Module
oaa_M00143
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:
oaa00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
100085312 (NDUFS1)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
100085312 (NDUFS1)
09159 Environmental adaptation
04714 Thermogenesis
100085312 (NDUFS1)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
100085312 (NDUFS1)
09164 Neurodegenerative disease
05010 Alzheimer disease
100085312 (NDUFS1)
05012 Parkinson disease
100085312 (NDUFS1)
05014 Amyotrophic lateral sclerosis
100085312 (NDUFS1)
05016 Huntington disease
100085312 (NDUFS1)
05020 Prion disease
100085312 (NDUFS1)
05022 Pathways of neurodegeneration - multiple diseases
100085312 (NDUFS1)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
100085312 (NDUFS1)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
100085312 (NDUFS1)
Enzymes [BR:
oaa01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
100085312 (NDUFS1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Molybdopterin
Fer4_Nqo3
Fer4_NDSU1
Fer2_4
NADH-G_4Fe-4S_3
NADH_dhqG_C
Fer2
Motif
Other DBs
NCBI-GeneID:
100085312
NCBI-ProteinID:
XP_028924856
Ensembl:
ENSOANG00000002321
LinkDB
All DBs
Position
7:73489809..73520570
Genome browser
AA seq
727 aa
AA seq
DB search
MLRLPLRRALTGVAQSTKGCVRTTATAASNLIEVFVDGQPVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKPVAACAMPVMKGWNILTNSEKSRKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNEMQVGTYIEKMFMSELSGNVIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPKMHEDINEEWISDKTRFSYDGLKRQ
RLTQPMVRNEKGLLTHTSWEDALSRVAGMLQNVQGSDVAAIVGGLVDAEALVSLKDLLNR
LDSDALCTEEVFPSAGAGTDLRSNYLLNTTIAGVEEADVLLLIGTNPRFEAPLFNARIRK
SWLHNELQVALVGSQVDLTYRYDHLGDSPKILQDLASGSHPFSQVLKQAKKPMVVLGSSA
LQRNDGAAVLAAVSTLAQSVRAGSGVGEDWKVMNILHRVASQVAALDLGYKPGVEAIRKH
PPKVLFLLGADGGCVTRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE
GRAQQTKTAVTPPGLAREDWKIIRALSEIAGLTLPYDTLDQVRNRLEEVSPNLVRYDDVE
GANYFRQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSIC
NT seq
2184 nt
NT seq
+upstream
nt +downstream
nt
atgttacgacttccgcttcgcagggccttaactggcgtggctcagtccaccaaaggatgt
gtgcgcacgacggcaactgcggccagcaacttgattgaagtgtttgttgatggacaacct
gtcatggtggaacctgggaccacggtgctccaggcatgtgaaaaagttggcatgcaaatc
ccccgcttctgttatcatgaaaggctgtctgttgctggaaactgcaggatgtgccttgtg
gagatcgagaaagcccctaagcctgtagctgcctgtgccatgccagtaatgaagggctgg
aacatactgacaaactctgagaagtccaggaaagcaagggagggtgtgatggaattctta
ctagcaaatcacccactggactgccccatctgtgaccagggaggtgaatgcgatctgcag
gaccagtcaatgatgttcggcagcgatagaagcagatttttagaaggaaaacgggctgtg
gaagataagaacattgggcctctggtgaagaccatcatgactagatgtatccagtgtacc
cgatgcatcaggtttgccagcgagattgcaggagtagatgatttaggaacaacaggcaga
ggaaatgagatgcaagttggcacgtacatcgagaagatgttcatgtctgagctgtcgggg
aatgtgatcgacatctgtcctgtgggggcccttacctctaagccctacgcttttactgct
cgtccttgggagaccagaaagacagaatccattgatgtgatggatgcggttggcagtaat
atcgtggtaagcacaaggactggagaagtgatgaggattttgccaaagatgcatgaagac
ataaatgaagaatggatttctgataaaactagattttcatacgacggattaaagcgtcag
cgacttacccagccaatggtcagaaacgaaaaggggcttttgacgcatacctcgtgggaa
gacgccctctccagggttgctggaatgttgcagaacgttcaaggcagtgatgtagcagca
atagttggtggtttggtggatgctgaagccctggtctccctcaaagacttacttaataga
ctagactctgacgcgctgtgcaccgaggaggtcttcccttctgcaggagctggcacagac
ctgcgctccaactacctccttaatacaacaattgctggtgtggaggaagcagatgtgttg
cttctcataggcacaaatccacgctttgaggcaccgctgtttaacgcaagaattcgaaag
agctggctccataatgagctgcaagtggctcttgtagggagtcaagtagatctgacttat
cgatacgatcatctgggagattcccccaagatcctgcaggaccttgcttccggaagccat
ccgttcagccaggtcctgaagcaagccaaaaaacccatggtggttttaggcagctcggcc
ctgcaacgcaacgacggagccgccgtccttgccgccgtctccaccctggcccagagcgtc
cgtgccggcagcggagtcggcgaggactggaaggttatgaatatcctccacagggtggcg
agccaggtcgcggctttggatctcggttataaacccggagtggaggccatccggaagcac
ccacccaaagtgttgtttctcctgggagcagatggaggctgcgttacccgccaggatttg
cccaaagattgcttcattatctatcaaggacatcatggtgatgtgggagcacccatagct
gacgtgattctcccgggggcggcttacacggagaagtccgccacctacgtcaacaccgag
gggagagctcagcagaccaaaaccgcagtgaccccgcccggcctggccagagaagattgg
aaaattatccgcgctctttccgagatagctggcctgaccctcccgtatgataccctggat
caagtgagaaatagattggaagaagtgtccccgaacctggtacgatacgacgacgtagag
ggagccaattatttccgccaagccaatgagctgtccaagttggtgaatcagcagctgctc
gccgatcctcttgttccaccccagctcacaatcaaagacttctacatgacagattccatc
agcagagcctcccagacgatggccaagtgcgtgaaagccgtgacggagggggctcaggcg
gtggaagagccgtccatctgctga
DBGET
integrated database retrieval system