Ornithorhynchus anatinus (platypus): 100086513
Help
Entry
100086513 CDS
T01045
Name
(RefSeq) vomeronasal 1 receptor ornAnaV1R3002
KO
K04614
vomeronasal 1 receptor
Organism
oaa
Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:
oaa00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04030 G protein-coupled receptors [BR:
oaa04030
]
100086513
G protein-coupled receptors [BR:
oaa04030
]
Others
Chemoreception
Vomeronasal pheromone
100086513
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
V1R
TAS2R
7tm_1
Motif
Other DBs
NCBI-GeneID:
100086513
NCBI-ProteinID:
NP_001240323
Ensembl:
ENSOANG00000044297
UniProt:
A0A6I8NWU3
LinkDB
All DBs
Position
X3:32567484..32568422
Genome browser
AA seq
312 aa
AA seq
DB search
MDSTELPFGIVTLLHVSIGVSVNVFLLLFYARLVSTSRRTSSSELILTQLALANTIILLT
SGIAETLSAWGLRNFLGDVGCKILSYLYRVARGLAICTTCLLSVFQAVTVSPGTSRWAGV
KAKLHRCIVPFCLLSWVLNMLVECSVAIQMTGPQNRSHSQNVMDHKYCSHVFGSPETTWA
LTVLVSLRDVSFVGLMSLASGYMVFVLHRHHRQVRHLHGPGRSPRVMPEVRAAKRVIALV
TLYVLLYGRQTITLSILLNLKDKSPLLVKSHMVLSFTFSAVSPFLVIHRDQRIRMFRQRE
SADSHLDLPAPS
NT seq
939 nt
NT seq
+upstream
nt +downstream
nt
atggacagcaccgagctcccctttgggatcgtaactctgttacatgtcagcatcggcgta
tcagtgaacgtcttcctcctcctgttttacgcccggctggtctccaccagccggagaacc
agctcctctgagctgatcctcacccagctggccctggccaacaccatcatcctcctcacc
agtggaatcgctgagaccttgtcagcttgggggctgagaaatttcttgggcgatgttggc
tgtaaaatcctctcatacctctaccgagtggcccggggcctggccatctgcaccacctgc
ctcctgagcgtcttccaggccgtcaccgtcagccccggcacctcccggtgggcgggggtc
aaagccaaattacacagatgcatcgtccctttctgcctcctctcctgggtccttaatatg
ttggtagagtgtagtgtagcgatacagatgacgggccctcagaacaggagccattcacag
aacgtgatggatcacaaatattgctcacatgtctttggcagtccagaaactacttgggca
ttaacagttctggtgtcgctccgtgacgtgtccttcgtggggctcatgagcttggccagc
ggctacatggtgtttgtcctacacagacaccaccggcaggtccgccacctccacgggccc
ggtcgctcccccagggtgatgcccgaggtccgagcggccaagagagtcatcgccctggtc
accctctacgtcctcctctacgggagacagaccatcacgttgagcattttactcaacctg
aaagacaagtctcccctcctggtgaaaagccacatggtgctgtccttcaccttctcagcc
gtcagtcccttcctggtgatccacagggaccagaggatcaggatgttccggcaaagggaa
tctgctgattcccatctggatctgcctgccccctcgtag
DBGET
integrated database retrieval system