Ornithorhynchus anatinus (platypus): 100089135 Help Entry 100089135         CDS       T01045                                  Symbol FGF20 Name (RefSeq) fibroblast growth factor 20   KO K04358   fibroblast growth factor Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04010   MAPK signaling pathway oaa04014   Ras signaling pathway oaa04015   Rap1 signaling pathway oaa04020   Calcium signaling pathway oaa04151   PI3K-Akt signaling pathway oaa04810   Regulation of actin cytoskeleton oaa05200   Pathways in cancer oaa05207   Chemical carcinogenesis - receptor activation oaa05218   Melanoma oaa05224   Breast cancer oaa05226   Gastric cancer Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100089135 (FGF20)    04014 Ras signaling pathway     100089135 (FGF20)    04015 Rap1 signaling pathway     100089135 (FGF20)    04020 Calcium signaling pathway     100089135 (FGF20)    04151 PI3K-Akt signaling pathway     100089135 (FGF20)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100089135 (FGF20)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100089135 (FGF20)    05207 Chemical carcinogenesis - receptor activation     100089135 (FGF20)   09162 Cancer: specific types    05226 Gastric cancer     100089135 (FGF20)    05218 Melanoma     100089135 (FGF20)    05224 Breast cancer     100089135 (FGF20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oaa04052]     100089135 (FGF20)    00536 Glycosaminoglycan binding proteins [BR:oaa00536]     100089135 (FGF20) Cytokines and neuropeptides [BR:oaa04052]  Cytokines   Growth factors (RTK binding)    100089135 (FGF20) Glycosaminoglycan binding proteins [BR:oaa00536]  Heparan sulfate / Heparin   Growth factors/receptors    100089135 (FGF20) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100089135 NCBI-ProteinID:  XP_028932966 Ensembl:  ENSOANG00000044400 UniProt:  A0A6I8NXV2 LinkDB All DBs Position 12:complement(98338..107199) Genome browser AA seq 193 aa AA seqDB search MAPLAEAGGLLGVPDGLVQSGPPQLLLPPAGERPGPPGLAHLQGLLRRRQLYCRTGFHLQ ILPDGRVRGTRQDHSLFGILEFISVAVGLVSIRGVDTGLYLGMNDKGELYGSEKLTSECV FREQFEENWYNTYSSNMYKHGTSGRRYFVALNRDGSPRDGARAKRHQKFTHFLPRPVDPE RTPNLYRDVRGPS NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcgcccctggccgaggccggcggcctcctgggcgtcccggacgggctggtccagtcc ggacccccccagctcctgctgccccccgccggggagcgcccgggaccccccggcctcgcc cacctgcagggcctcctgcgccggaggcagctctactgtcggaccggcttccacctgcag atcctgcccgacggccgcgtcaggggcacccgccaggaccacagcctcttcggaatcctg gaattcatcagcgtggctgtgggcctggtcagcatccgcggcgtggacactggtctctat ctcggcatgaatgacaaaggggagctgtatggatctgagaagctgacctcagagtgtgtt ttcagggagcagtttgaagagaactggtataatacttactcctccaacatgtacaagcac gggacctcggggcgccggtactttgtggccctgaacagagatggttctccgagggacggc gcccgggccaagaggcaccagaagtttacccatttcctgcccaggcctgtggacccggag cggactcccaacctctaccgagacgtccggggtcccagctga

DBGET integrated database retrieval system