Ornithorhynchus anatinus (platypus): 100089376 Help Entry 100089376         CDS       T01045                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04613   Neutrophil extracellular trap formation oaa05034   Alcoholism oaa05203   Viral carcinogenesis oaa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oaa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100089376  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100089376   09163 Immune disease    05322 Systemic lupus erythematosus     100089376   09165 Substance dependence    05034 Alcoholism     100089376  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oaa03036]     100089376   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oaa04147]     100089376 Chromosome and associated proteins [BR:oaa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100089376 Exosome [BR:oaa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100089376 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  100089376 NCBI-ProteinID:  XP_001512983 Ensembl:  ENSOANG00000040672 UniProt:  F7DNX4 LinkDB All DBs Position X5:3750547..3751013 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggccaagtccgctccggcccccaagaagggctccaagaaagcggtgacc aaagcgcagaagaaagacgggaagaagcgcaagcggagccgcaaggagagctactccatc tacgtgtacaaggtgctgaagcaggtccaccccgacacgggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcttcccgc ctggcgcactacaacaagcgctccaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system