Ornithorhynchus anatinus (platypus): 100090081 Help Entry 100090081         CDS       T01045                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04024   cAMP signaling pathway oaa04062   Chemokine signaling pathway oaa04064   NF-kappa B signaling pathway oaa04210   Apoptosis oaa04380   Osteoclast differentiation oaa04620   Toll-like receptor signaling pathway oaa04621   NOD-like receptor signaling pathway oaa04622   RIG-I-like receptor signaling pathway oaa04623   Cytosolic DNA-sensing pathway oaa04625   C-type lectin receptor signaling pathway oaa04657   IL-17 signaling pathway oaa04658   Th1 and Th2 cell differentiation oaa04659   Th17 cell differentiation oaa04660   T cell receptor signaling pathway oaa04662   B cell receptor signaling pathway oaa04668   TNF signaling pathway oaa04722   Neurotrophin signaling pathway oaa04920   Adipocytokine signaling pathway oaa04926   Relaxin signaling pathway oaa04931   Insulin resistance oaa04936   Alcoholic liver disease oaa05132   Salmonella infection oaa05134   Legionellosis oaa05135   Yersinia infection oaa05140   Leishmaniasis oaa05142   Chagas disease oaa05145   Toxoplasmosis oaa05160   Hepatitis C oaa05161   Hepatitis B oaa05162   Measles oaa05163   Human cytomegalovirus infection oaa05164   Influenza A oaa05166   Human T-cell leukemia virus 1 infection oaa05167   Kaposi sarcoma-associated herpesvirus infection oaa05168   Herpes simplex virus 1 infection oaa05169   Epstein-Barr virus infection oaa05170   Human immunodeficiency virus 1 infection oaa05171   Coronavirus disease - COVID-19 oaa05200   Pathways in cancer oaa05203   Viral carcinogenesis oaa05208   Chemical carcinogenesis - reactive oxygen species oaa05215   Prostate cancer oaa05220   Chronic myeloid leukemia oaa05222   Small cell lung cancer oaa05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oaa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100090081 (NFKBIA)    04668 TNF signaling pathway     100090081 (NFKBIA)    04024 cAMP signaling pathway     100090081 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100090081 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100090081 (NFKBIA)    04621 NOD-like receptor signaling pathway     100090081 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     100090081 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     100090081 (NFKBIA)    04625 C-type lectin receptor signaling pathway     100090081 (NFKBIA)    04660 T cell receptor signaling pathway     100090081 (NFKBIA)    04658 Th1 and Th2 cell differentiation     100090081 (NFKBIA)    04659 Th17 cell differentiation     100090081 (NFKBIA)    04657 IL-17 signaling pathway     100090081 (NFKBIA)    04662 B cell receptor signaling pathway     100090081 (NFKBIA)    04062 Chemokine signaling pathway     100090081 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100090081 (NFKBIA)    04926 Relaxin signaling pathway     100090081 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100090081 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     100090081 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100090081 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     100090081 (NFKBIA)    05203 Viral carcinogenesis     100090081 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100090081 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     100090081 (NFKBIA)    05215 Prostate cancer     100090081 (NFKBIA)    05222 Small cell lung cancer     100090081 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100090081 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     100090081 (NFKBIA)    05161 Hepatitis B     100090081 (NFKBIA)    05160 Hepatitis C     100090081 (NFKBIA)    05171 Coronavirus disease - COVID-19     100090081 (NFKBIA)    05164 Influenza A     100090081 (NFKBIA)    05162 Measles     100090081 (NFKBIA)    05168 Herpes simplex virus 1 infection     100090081 (NFKBIA)    05163 Human cytomegalovirus infection     100090081 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     100090081 (NFKBIA)    05169 Epstein-Barr virus infection     100090081 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100090081 (NFKBIA)    05135 Yersinia infection     100090081 (NFKBIA)    05134 Legionellosis     100090081 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100090081 (NFKBIA)    05140 Leishmaniasis     100090081 (NFKBIA)    05142 Chagas disease     100090081 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100090081 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100090081 (NFKBIA)    04931 Insulin resistance     100090081 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oaa03000]     100090081 (NFKBIA)    04131 Membrane trafficking [BR:oaa04131]     100090081 (NFKBIA) Transcription factors [BR:oaa03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     100090081 (NFKBIA) Membrane trafficking [BR:oaa04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100090081 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank Ank_2 Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  100090081 NCBI-ProteinID:  XP_001519324 Ensembl:  ENSOANG00000043305 UniProt:  A0A6I8ND87 LinkDB All DBs Position 14:complement(13223540..13227050) Genome browser AA seq 329 aa AA seqDB search MFAAAAAAAGQGQRPRDGGPDGPKKDRALGEDRHDSGLDSMKDEDYELMVQELSAIRLQP QAQARSRPQEAMAPPPPAEPWRHQVTEDGDSFLHLAVIHEEKALALEVIRRVKGDLAFLD LQNSLQQTPLHLAVITSQPEIAETLLKAGCDPELRDFRGNTALHLACEQGCLAAVGVLTQ YCQTQHLHAVLQASNYNGHTCLHLASIHGYLAIVERLVSLGADVNAQEPCNGRTALHLAV DLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRESTSIQQQLGQLTMSNLQLLPESED EESCDTESEFTEDELLYDDCVIGGQRLAL NT seq 990 nt NT seq  +upstreamnt  +downstreamnt atgttcgccgccgccgccgccgccgccgggcaggggcagcgcccccgggatgggggtccc gacgggcccaagaaggacagggccctgggcgaggaccgccacgacagcggcctggactcc atgaaggacgaggactacgagctgatggtgcaggagctgagcgccatccgcctccagccc caggcccaggcccggtctaggccgcaggaagccatggcgccgcccccgcccgccgagccc tggaggcaccaagtcaccgaggacggagactcgttcctgcacttggccgtcatccacgag gagaaggccctggccctggaggtcatccgccgggtcaagggcgacctcgccttcctggac ctccagaacagcctgcagcagactccgcttcacttggccgtgatcaccagccagcccgag atcgcagagaccctcctgaaagccggctgcgaccccgagctgcgggacttccgggggaac acggccctgcacctggcctgtgagcagggctgcctggctgcggtgggggtcctcacccag tactgccagacgcagcatctccacgccgtcctgcaggccagcaactacaacggtcacacg tgtctccacttggcctccattcacggctacctggcaatcgtagagcgcttggtgtccttg ggagctgacgtcaatgcccaggagccctgtaacggccggacggcactgcacctcgcagtc gacctgcagaatcccgacttggtgtcactcctgctcaagtgcggggccgatgtcaaccga gtcacctaccagggctactcgccgtaccagctcacctggggcagagagagcaccagcatc cagcagcagctgggccagctgaccatgtccaatctgcagctgctgccggagagcgaggat gaggagagctgcgacaccgagtcggaattcacagaggacgaactgctctatgacgactgt gtaattggaggccagcgcctggcgttgtga

DBGET integrated database retrieval system