Ornithorhynchus anatinus (platypus): 100093050 Help Entry 100093050         CDS       T01045                                  Name (RefSeq) ADP-ribosylation factor 6-like   KO K07941   ADP-ribosylation factor 6 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04014   Ras signaling pathway oaa04072   Phospholipase D signaling pathway oaa04144   Endocytosis oaa04666   Fc gamma R-mediated phagocytosis oaa05132   Salmonella infection oaa05135   Yersinia infection Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100093050    04072 Phospholipase D signaling pathway     100093050  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100093050  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     100093050  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100093050    05135 Yersinia infection     100093050  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oaa04131]     100093050   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oaa04147]     100093050    04031 GTP-binding proteins [BR:oaa04031]     100093050 Membrane trafficking [BR:oaa04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     100093050   Arf GTPases and associated proteins    Arf GTPases     100093050 Exosome [BR:oaa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100093050   Exosomal proteins of colorectal cancer cells    100093050 GTP-binding proteins [BR:oaa04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     100093050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc Ras G-alpha SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  100093050 NCBI-ProteinID:  XP_028920649 Ensembl:  ENSOANG00000044870 UniProt:  F6URT1 LinkDB All DBs Position 5:complement(3044700..3047050) Genome browser AA seq 175 aa AA seqDB search MGKMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLVFVVDCADRDRVDEARQELHRIINDREMRDAIVLVF ANKQDLPDAMKPHEVQEKLGLTRVRDRNWYVQPSCATTGEGLCEGLMWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaagatgctgtccaagatcttcggcaacaaggagatgcgcatcctgatgctgggc ctggacgcggccgggaagaccaccatcctctacaagctgaagctgggccagtcggtcacc accatccccaccgtgggcttcaacgtggagacggtcacctacaagaacgtcaagttcaac gtgtgggacgtggggggccaggacaagatccgcccgctgtggcggcactactacacgggc acgcagggcctggtgttcgtggtggactgcgccgaccgggaccgcgtggacgaggcccgc caggagctgcaccgcatcatcaacgaccgggagatgcgggacgccatcgtcctggtcttc gccaacaagcaggacctgccggacgccatgaagccccacgaggtccaggagaagctgggc ctgacccgggtccgggaccggaactggtacgtccagccgtcgtgcgccaccaccggcgag gggctctgtgaggggctcatgtggctgacgtccaactacaagtcttaa

DBGET integrated database retrieval system