Ornithorhynchus anatinus (platypus): 103165286 Help Entry 103165286         CDS       T01045                                  Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa01523   Antifolate resistance oaa04010   MAPK signaling pathway oaa04060   Cytokine-cytokine receptor interaction oaa04064   NF-kappa B signaling pathway oaa04217   Necroptosis oaa04380   Osteoclast differentiation oaa04620   Toll-like receptor signaling pathway oaa04621   NOD-like receptor signaling pathway oaa04623   Cytosolic DNA-sensing pathway oaa04625   C-type lectin receptor signaling pathway oaa04640   Hematopoietic cell lineage oaa04657   IL-17 signaling pathway oaa04659   Th17 cell differentiation oaa04668   TNF signaling pathway oaa04750   Inflammatory mediator regulation of TRP channels oaa04932   Non-alcoholic fatty liver disease oaa04933   AGE-RAGE signaling pathway in diabetic complications oaa04936   Alcoholic liver disease oaa04940   Type I diabetes mellitus oaa05010   Alzheimer disease oaa05020   Prion disease oaa05022   Pathways of neurodegeneration - multiple diseases oaa05132   Salmonella infection oaa05133   Pertussis oaa05134   Legionellosis oaa05135   Yersinia infection oaa05140   Leishmaniasis oaa05142   Chagas disease oaa05143   African trypanosomiasis oaa05144   Malaria oaa05146   Amoebiasis oaa05152   Tuberculosis oaa05162   Measles oaa05163   Human cytomegalovirus infection oaa05164   Influenza A oaa05168   Herpes simplex virus 1 infection oaa05171   Coronavirus disease - COVID-19 oaa05321   Inflammatory bowel disease oaa05323   Rheumatoid arthritis oaa05332   Graft-versus-host disease oaa05417   Lipid and atherosclerosis oaa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103165286    04064 NF-kappa B signaling pathway     103165286    04668 TNF signaling pathway     103165286   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103165286  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103165286  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103165286    04620 Toll-like receptor signaling pathway     103165286    04621 NOD-like receptor signaling pathway     103165286    04623 Cytosolic DNA-sensing pathway     103165286    04625 C-type lectin receptor signaling pathway     103165286    04659 Th17 cell differentiation     103165286    04657 IL-17 signaling pathway     103165286   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103165286   09158 Development and regeneration    04380 Osteoclast differentiation     103165286  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     103165286    05164 Influenza A     103165286    05162 Measles     103165286    05168 Herpes simplex virus 1 infection     103165286    05163 Human cytomegalovirus infection     103165286   09171 Infectious disease: bacterial    05132 Salmonella infection     103165286    05135 Yersinia infection     103165286    05133 Pertussis     103165286    05134 Legionellosis     103165286    05152 Tuberculosis     103165286   09174 Infectious disease: parasitic    05146 Amoebiasis     103165286    05144 Malaria     103165286    05140 Leishmaniasis     103165286    05142 Chagas disease     103165286    05143 African trypanosomiasis     103165286   09163 Immune disease    05323 Rheumatoid arthritis     103165286    05321 Inflammatory bowel disease     103165286    05332 Graft-versus-host disease     103165286   09164 Neurodegenerative disease    05010 Alzheimer disease     103165286    05020 Prion disease     103165286    05022 Pathways of neurodegeneration - multiple diseases     103165286   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103165286    05418 Fluid shear stress and atherosclerosis     103165286   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103165286    04936 Alcoholic liver disease     103165286    04932 Non-alcoholic fatty liver disease     103165286    04933 AGE-RAGE signaling pathway in diabetic complications     103165286   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     103165286  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oaa04052]     103165286    00536 Glycosaminoglycan binding proteins [BR:oaa00536]     103165286 Cytokines and neuropeptides [BR:oaa04052]  Cytokines   Interleukins    103165286 Glycosaminoglycan binding proteins [BR:oaa00536]  Heparan sulfate / Heparin   Cytokines    103165286 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep PACT_coil_coil Motif Other DBs NCBI-GeneID:  103165286 NCBI-ProteinID:  XP_007654950 Ensembl:  ENSOANG00000010546 UniProt:  F6U6X6 LinkDB All DBs Position 11:1994773..2001474 Genome browser AA seq 320 aa AA seqDB search MPAYGEQDSSREVEETDDKKTKRQPGLESTMARVPDQSRDLMECYSGDGEDQFYEVDGPS QIKSGFQDLKARTCQETRIHKEDKCSPCQMGIELKVTELPSSHGFRKAVVLVVAVERIKR QAVSYNTSFMDRDLMDIFTSIFKEEPISCSTWEQTLVTDSLYHYLRCQEVTIWDEEHKSF TLNTMANPCELRALHLIGANATQEVKLNMNFYYKTERLAGPTVKQPVTLGIKGGNPGNLY LSCVKKGGKPTLQLEVVNKSDLLGKNQERFIFNKSTEGTSTTFESAAYPDWYISTSREED EPVFLGASKGEEAITNFFLH NT seq 963 nt NT seq  +upstreamnt  +downstreamnt atgccagcctacggggaacaagacagttccagagaggtggaggagacagacgacaagaaa actaagagacaaccaggtttggaatcaaccatggccagagtaccagaccagtccagggac ctgatggagtgctacagtggagatggagaagaccagttctatgaagtcgacggtcccagt caaataaagagtggtttccaggacctgaaggcaaggacatgccaagagacaagaatccat aaggaggacaaatgctcaccatgccagatgggcatcgagctgaaggtcacagaactcccc tccagccacggcttccgcaaggcggtggtcctcgttgtcgccgtggagaggataaagaga caggcggtgtcctacaacacgtcctttatggacagggacctgatggacatcttcacctct atcttcaaggaagaacccatctcctgttcgacgtgggaacagaccttggtgaccgactca ctctaccactacttgagatgccaggaggtcaccatctgggatgaggagcacaagagcttc accctgaacaccatggctaatccctgcgagctgagagcgctgcacctcataggtgctaac gctacccaagaagtgaagttaaacatgaacttctactacaagacagagcgcctggcaggt cccacagtgaagcagcccgtgactttggggatcaaggggggaaacccagggaacctgtac ctgtcttgtgtgaagaaaggcggcaagcccactctgcagctggaggtggtcaacaagagc gaccttttggggaagaatcaggagcgcttcatcttcaataagtccaccgaggggacgtcc accaccttcgaatcggccgcctaccccgactggtacatcagcacctcccgggaggaggac gagccagtcttcctgggggccagcaagggggaggaggccatcaccaatttcttcctgcac tag

DBGET integrated database retrieval system