Ornithorhynchus anatinus (platypus): 103165905 Help Entry 103165905         CDS       T01045                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04060   Cytokine-cytokine receptor interaction oaa04630   JAK-STAT signaling pathway oaa04640   Hematopoietic cell lineage oaa04657   IL-17 signaling pathway oaa04658   Th1 and Th2 cell differentiation oaa04660   T cell receptor signaling pathway oaa04664   Fc epsilon RI signaling pathway oaa04672   Intestinal immune network for IgA production oaa05200   Pathways in cancer oaa05310   Asthma oaa05320   Autoimmune thyroid disease oaa05321   Inflammatory bowel disease oaa05330   Allograft rejection Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103165905 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103165905 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     103165905 (IL5)    04660 T cell receptor signaling pathway     103165905 (IL5)    04658 Th1 and Th2 cell differentiation     103165905 (IL5)    04657 IL-17 signaling pathway     103165905 (IL5)    04664 Fc epsilon RI signaling pathway     103165905 (IL5)    04672 Intestinal immune network for IgA production     103165905 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103165905 (IL5)   09163 Immune disease    05310 Asthma     103165905 (IL5)    05320 Autoimmune thyroid disease     103165905 (IL5)    05321 Inflammatory bowel disease     103165905 (IL5)    05330 Allograft rejection     103165905 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oaa04052]     103165905 (IL5)    00536 Glycosaminoglycan binding proteins [BR:oaa00536]     103165905 (IL5) Cytokines and neuropeptides [BR:oaa04052]  Cytokines   Interleukins    103165905 (IL5) Glycosaminoglycan binding proteins [BR:oaa00536]  Heparan sulfate / Heparin   Cytokines    103165905 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  103165905 NCBI-ProteinID:  XP_007656238 Ensembl:  ENSOANG00000040098 UniProt:  A0A6I8P6S9 LinkDB All DBs Position X1:40578117..40580905 Genome browser AA seq 132 aa AA seqDB search MTSTDIALRRLASEALIMLQTHQTLLLGNGTLKISTPHQNDNLLCIEEIFQGIGTLKNHT TKGHLGTEAFFHGLSSLRDHISIEEKKCRGPRRNVGDFLKHLQIFLQQIKTDGIGRKCDS CKAAETEEAEKA NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgacttccacagatattgcactgaggagactggcttcagaagcactgataatgctccag actcatcagactctgctgttaggcaacgggactttaaagatttctacacctcatcaaaat gataacctcttgtgcattgaagaaatcttccagggaataggcacactgaaaaaccacacc accaaaggacatttaggcacagaagccttttttcacggcttatcttcactaagagaccac atatccatcgaagaaaagaagtgcagagggccaaggagaaacgttggagacttcctgaaa cacctgcagatatttctccaacagatcaagacagatggcatcgggagaaaatgtgattcg tgtaaagccgcagagacggaggaggcagaaaaggcttaa

DBGET integrated database retrieval system