Ornithorhynchus anatinus (platypus): 103169212 Help Entry 103169212         CDS       T01045                                  Symbol MRAS Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04010   MAPK signaling pathway oaa04014   Ras signaling pathway oaa04015   Rap1 signaling pathway oaa04072   Phospholipase D signaling pathway oaa04137   Mitophagy - animal oaa04140   Autophagy - animal oaa04218   Cellular senescence oaa04371   Apelin signaling pathway oaa04625   C-type lectin receptor signaling pathway oaa04810   Regulation of actin cytoskeleton oaa05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103169212 (MRAS)    04014 Ras signaling pathway     103169212 (MRAS)    04015 Rap1 signaling pathway     103169212 (MRAS)    04371 Apelin signaling pathway     103169212 (MRAS)    04072 Phospholipase D signaling pathway     103169212 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103169212 (MRAS)    04137 Mitophagy - animal     103169212 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     103169212 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103169212 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103169212 (MRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103169212 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:oaa04031]     103169212 (MRAS) GTP-binding proteins [BR:oaa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103169212 (MRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  103169212 NCBI-ProteinID:  XP_028929786 Ensembl:  ENSOANG00000007543 UniProt:  A0A6I8NZD3 LinkDB All DBs Position 1:complement(173356009..173494007) Genome browser AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGREMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRAPSSHRLQCAIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcgaccagtgctgtcccgagcgacaatctccccacgtacaaactggtggtggtggga gatggcggcgtgggcaagagcgccctgaccattcagtttttccagaagatctttgtgcct gactacgaccccaccatcgaggactcctacctgaagcacaccgagattgacggccagtgg gccatcctggacgttctagacacggcaggacaggaggaattcagcgccatgagggagcag tacatgaggacgggagacggctttctcatcgtcttctcggtcacggataaggccagtttt gaacacgtggaccgcttccaccagttaatcctcagagtgaaggacagggagtcctttccg atgatcttggtggccaataaagttgatctgatgcacttgcgaaaaatcaccagggaacaa ggaagagaaatggcaacgaaacacaatattccgtacatagaaaccagtgccaaggaccca ccactaaatgtggataaagccttccatgacctcgttagagtcatcaggcaacagatccca gagaaaagccagaagaagaagaaaaagacaaaatggcggggggacagggcccccagctcc cacagactacaatgcgcgatattgtga

DBGET integrated database retrieval system