Ornithorhynchus anatinus (platypus): 103170562 Help Entry 103170562         CDS       T01045                                  Name (RefSeq) C-X-C motif chemokine 11   KO K12672   C-X-C motif chemokine 11 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04060   Cytokine-cytokine receptor interaction oaa04061   Viral protein interaction with cytokine and cytokine receptor oaa04062   Chemokine signaling pathway oaa04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103170562    04061 Viral protein interaction with cytokine and cytokine receptor     103170562  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103170562    04062 Chemokine signaling pathway     103170562  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oaa04052]     103170562 Cytokines and neuropeptides [BR:oaa04052]  Cytokines   Chemokines    103170562 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103170562 NCBI-ProteinID:  XP_007667369 LinkDB All DBs Position 10:complement(8850824..8854576) Genome browser AA seq 101 aa AA seqDB search MAGKASNLLVALVLLATLMPVVPRFRGSRCLCIGPRVNSVTPMQIKSISVFLPTSTCDRK EVIVTLKKGKGQRCLNLDSKQAQLILKRIVEIKKVPQEKRT NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcggggaaggcgtctaacctcctcgtggccctggttctgctcgccacactgatgcca gtcgtccccaggttccgagggagtcgctgcctctgtatcggccccagagtgaactcggtg accccgatgcagatcaagagcatctctgtcttcctcccgaccagcacctgtgaccgcaag gaggtgatcgtcaccctgaagaaggggaaggggcagaggtgtctgaacctggactccaag caagctcaactcattctcaagagaatagtggaaataaaaaaggtcccgcaagagaagagg acctga

DBGET integrated database retrieval system