Ornithorhynchus anatinus (platypus): 107547246 Help Entry 107547246         CDS       T01045                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04613   Neutrophil extracellular trap formation oaa05034   Alcoholism oaa05203   Viral carcinogenesis oaa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oaa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107547246  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     107547246   09163 Immune disease    05322 Systemic lupus erythematosus     107547246   09165 Substance dependence    05034 Alcoholism     107547246  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oaa03036]     107547246 Chromosome and associated proteins [BR:oaa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107547246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  107547246 NCBI-ProteinID:  XP_016081622 Ensembl:  ENSOANG00000049861 LinkDB All DBs Position X5:4142920..4143303 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccggtcggggcaaaggtggtaaggggctggggaaaggcggcgctaaacgccatagg aaggtgctgcgggataacatccagggcatcaccaagcctgccatccgtcgcttggctcgc cgtggaggagtcaagcgcatttccgggctgatctacgaggagacccgcggggtgctcaag gttttcctggagaacgtcatccgggacgccgttacctatacggagcacgccaagaggaag accgttactgccatggacgtcgtttacgctctgaagcgtcaaggccgcaccctctacggc ttcggcggttga

DBGET integrated database retrieval system