Ornithorhynchus anatinus (platypus): 114806611 Help Entry 114806611         CDS       T01045                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04810   Regulation of actin cytoskeleton oaa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oaa00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     114806611 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114806611 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  114806611 NCBI-ProteinID:  XP_028907867 Ensembl:  ENSOANG00000043269 UniProt:  A0A6I8NBK1 LinkDB All DBs Position X1:85638170..85644966 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcggggcaggaggatccggtgcagcgggagatccaccaagactgggctaaccgcgag tacatcgaggtcatcaccagcagcatcaagaagatcgccgacttcctcaattcgttcgac atgtcctgccgctcaaggttggccacgctgaatgagaagctgacggctctggagcggaga atcgagtacatcgaagcgagggtgacaaagggtgagactctcacctag

DBGET integrated database retrieval system