Ornithorhynchus anatinus (platypus): 114807921 Help Entry 114807921         CDS       T01045                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04382   Cornified envelope formation oaa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oaa00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     114807921 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114807921 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oaa04147]     114807921 (S100A10) Exosome [BR:oaa04147]  Exosomal proteins   Exosomal proteins of microglial cells    114807921 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  114807921 NCBI-ProteinID:  XP_028910607 Ensembl:  ENSOANG00000009693 UniProt:  A0A6I8N3E5 LinkDB All DBs Position X5:1826506..1831942 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHRFAGDKGYLTKDDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGRVGFQSFFSLIAGLIIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggagaccatgatgttcaccttccatcggtttgct ggggataagggttacctgaccaaggatgatctgagggtgctgatggagaaagagttcccc ggattcttggaaaaccagaaggaccctctggccgtggataagatcatgaaggacttggac cagtgccgggatggcagagtgggtttccagagcttcttctcgctgatcgccgggctgatc atcgcttgcaacgactacttcgtggtgcacatgaagcagaaagggaagaaatga

DBGET integrated database retrieval system