Ornithorhynchus anatinus (platypus): 114807967 Help Entry 114807967         CDS       T01045                                  Name (RefSeq) interferon epsilon-like   KO K05414   interferon alpha Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04060   Cytokine-cytokine receptor interaction oaa04151   PI3K-Akt signaling pathway oaa04217   Necroptosis oaa04620   Toll-like receptor signaling pathway oaa04621   NOD-like receptor signaling pathway oaa04622   RIG-I-like receptor signaling pathway oaa04623   Cytosolic DNA-sensing pathway oaa04630   JAK-STAT signaling pathway oaa04650   Natural killer cell mediated cytotoxicity oaa04936   Alcoholic liver disease oaa05152   Tuberculosis oaa05160   Hepatitis C oaa05161   Hepatitis B oaa05162   Measles oaa05163   Human cytomegalovirus infection oaa05164   Influenza A oaa05165   Human papillomavirus infection oaa05167   Kaposi sarcoma-associated herpesvirus infection oaa05168   Herpes simplex virus 1 infection oaa05169   Epstein-Barr virus infection oaa05170   Human immunodeficiency virus 1 infection oaa05171   Coronavirus disease - COVID-19 oaa05200   Pathways in cancer oaa05320   Autoimmune thyroid disease oaa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     114807967    04151 PI3K-Akt signaling pathway     114807967   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114807967  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     114807967  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114807967    04621 NOD-like receptor signaling pathway     114807967    04622 RIG-I-like receptor signaling pathway     114807967    04623 Cytosolic DNA-sensing pathway     114807967    04650 Natural killer cell mediated cytotoxicity     114807967  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114807967   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     114807967    05161 Hepatitis B     114807967    05160 Hepatitis C     114807967    05171 Coronavirus disease - COVID-19     114807967    05164 Influenza A     114807967    05162 Measles     114807967    05168 Herpes simplex virus 1 infection     114807967    05163 Human cytomegalovirus infection     114807967    05167 Kaposi sarcoma-associated herpesvirus infection     114807967    05169 Epstein-Barr virus infection     114807967    05165 Human papillomavirus infection     114807967   09171 Infectious disease: bacterial    05152 Tuberculosis     114807967   09163 Immune disease    05320 Autoimmune thyroid disease     114807967   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114807967   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     114807967  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oaa04052]     114807967 Cytokines and neuropeptides [BR:oaa04052]  Cytokines   Interferons    114807967 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon WH_Egal UVB_sens_C Motif Other DBs NCBI-GeneID:  114807967 NCBI-ProteinID:  XP_028910771 Ensembl:  ENSOANG00000038666 LinkDB All DBs Position X5:22926995..22927656 Genome browser AA seq 182 aa AA seqDB search MTNAGLIQIVLVLLVSTSTVSLSCSLLHTVCMEQSLKRLDRMQGKSLLSCLKDRKDFQLP QELVEAGPFKEGNRAVAVHELLQQIFTIFSQNLSQTGWDQSEVENFLHGLHRQLEELEVC AEQGTDTRWASVGSDILRLRLKSYFRSISLYLRDKDYSSCAWEIVRAQIRRCIFQFMRRL RN NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atgaccaacgccggtttgatacaaattgtccttgtgctgctcgtctccacctccactgtc tctctgagctgtagcctgcttcacacagtgtgtatggagcagagcttaaagcggctggac agaatgcagggaaaatctcttctgtcttgtctgaaggacaggaaggacttccaactcccc caggaattggtggaagccggaccgttcaaggaggggaatcgggcggtggccgtccatgag ctgctccagcagatcttcaccatcttcagccaaaatctttcccaaactggttgggaccag agcgaagtggagaatttcctccacggactccatcggcagctagaagagctcgaggtgtgc gcggagcagggtacggatacgagatgggcctctgtggggagcgacattctccgactgcgc ctgaagtcttacttcagaagcataagtctctacctgagggacaaagactacagcagctgc gcctgggagatcgtccgagcgcaaatccggaggtgcatcttccagttcatgagaaggctc cggaactaa

DBGET integrated database retrieval system