Ornithorhynchus anatinus (platypus): 114808039 Help Entry 114808039         CDS       T01045                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04015   Rap1 signaling pathway oaa04810   Regulation of actin cytoskeleton oaa05014   Amyotrophic lateral sclerosis oaa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     114808039 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     114808039 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114808039 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     114808039 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oaa04131]     114808039 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oaa04812]     114808039 (PFN1)    04147 Exosome [BR:oaa04147]     114808039 (PFN1) Membrane trafficking [BR:oaa04131]  Others   Actin-binding proteins    Others     114808039 (PFN1) Cytoskeleton proteins [BR:oaa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      114808039 (PFN1) Exosome [BR:oaa04147]  Exosomal proteins   Proteins found in most exosomes    114808039 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  114808039 NCBI-ProteinID:  XP_028911247 Ensembl:  ENSOANG00000042707 LinkDB All DBs Position X5:complement(7513464..7518025) Genome browser AA seq 140 aa AA seqDB search MAGWNAYVDNLMADGTCQDAAIVGHKDSPSVWAAVPGKTFANITPAEVGVLVGKDRSSFY VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNLTVTMTAKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggaacgcttacgtcgacaacctgatggccgatggcacgtgccaagatgcg gccatcgtgggccacaaggactcgccctccgtctgggccgccgtgccgggcaagaccttc gccaacatcacgccagcagaagttggggtgctggtgggcaaggaccggtcaagtttctac gtgaacgggctgacgctgggcggccagaagtgctccgtgatccgggactcgctgctgcag gatggggagttcaccatggatctgcgcactaagagcaccggaggggctcccaccttcaac ctcaccgtcaccatgaccgccaagacgctagttctgctcatgggcaaggagggcgtccac ggtggcttgatcaacaagaaatgctacgagatggcgtcccaccttaggcgttcccagtac tga

DBGET integrated database retrieval system