Ornithorhynchus anatinus (platypus): 114810063 Help Entry 114810063         CDS       T01045                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04010   MAPK signaling pathway oaa04014   Ras signaling pathway oaa04015   Rap1 signaling pathway oaa04022   cGMP-PKG signaling pathway oaa04066   HIF-1 signaling pathway oaa04068   FoxO signaling pathway oaa04072   Phospholipase D signaling pathway oaa04081   Hormone signaling oaa04114   Oocyte meiosis oaa04140   Autophagy - animal oaa04150   mTOR signaling pathway oaa04151   PI3K-Akt signaling pathway oaa04152   AMPK signaling pathway oaa04211   Longevity regulating pathway oaa04213   Longevity regulating pathway - multiple species oaa04810   Regulation of actin cytoskeleton oaa04910   Insulin signaling pathway oaa04911   Insulin secretion oaa04913   Ovarian steroidogenesis oaa04914   Progesterone-mediated oocyte maturation oaa04917   Prolactin signaling pathway oaa04923   Regulation of lipolysis in adipocytes oaa04930   Type II diabetes mellitus oaa04931   Insulin resistance oaa04932   Non-alcoholic fatty liver disease oaa04940   Type I diabetes mellitus oaa04950   Maturity onset diabetes of the young oaa04960   Aldosterone-regulated sodium reabsorption oaa05010   Alzheimer disease oaa05215   Prostate cancer oaa05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114810063 (INS)    04014 Ras signaling pathway     114810063 (INS)    04015 Rap1 signaling pathway     114810063 (INS)    04066 HIF-1 signaling pathway     114810063 (INS)    04068 FoxO signaling pathway     114810063 (INS)    04072 Phospholipase D signaling pathway     114810063 (INS)    04022 cGMP-PKG signaling pathway     114810063 (INS)    04151 PI3K-Akt signaling pathway     114810063 (INS)    04152 AMPK signaling pathway     114810063 (INS)    04150 mTOR signaling pathway     114810063 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     114810063 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114810063 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     114810063 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114810063 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     114810063 (INS)    04910 Insulin signaling pathway     114810063 (INS)    04923 Regulation of lipolysis in adipocytes     114810063 (INS)    04913 Ovarian steroidogenesis     114810063 (INS)    04914 Progesterone-mediated oocyte maturation     114810063 (INS)    04917 Prolactin signaling pathway     114810063 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     114810063 (INS)   09149 Aging    04211 Longevity regulating pathway     114810063 (INS)    04213 Longevity regulating pathway - multiple species     114810063 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     114810063 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     114810063 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     114810063 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     114810063 (INS)    04940 Type I diabetes mellitus     114810063 (INS)    04950 Maturity onset diabetes of the young     114810063 (INS)    04932 Non-alcoholic fatty liver disease     114810063 (INS)    04931 Insulin resistance     114810063 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oaa04052]     114810063 (INS) Cytokines and neuropeptides [BR:oaa04052]  Neuropeptides   Unclassified    114810063 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  114810063 NCBI-ProteinID:  XP_028915363 Ensembl:  ENSOANG00000044716 UniProt:  A0A6I8PEP2 LinkDB All DBs Position 3:1758530..1762024 Genome browser AA seq 106 aa AA seqDB search MALWVTVLPLLALLALSMPAPGGAFPNQHLCGSHLVEALYLVCGEKGFYYIPRGRRDAEE PVVRGLLQNGLNDLEFPSDLQVGKRGIVEECCKGVCSMYQLENYCN NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctctctgggtcacggtcctgcccttgctggccctcctggcactctcgatgcccgct cccggtggggccttccctaaccagcacctgtgtggctctcacctggtggaggctctctac ctggtgtgcggagaaaaaggcttctactacatcccccggggccgcagggatgccgaggag cctgtcgttcgtgggctcctccagaacgggttgaatgacctggagttcccctctgacctc caggtgggcaagaggggcatcgtggaggaatgctgcaaaggcgtctgctccatgtaccag ctggaaaattactgcaactag

DBGET integrated database retrieval system