Ornithorhynchus anatinus (platypus): 120638153 Help Entry 120638153         CDS       T01045                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04613   Neutrophil extracellular trap formation oaa05034   Alcoholism oaa05202   Transcriptional misregulation in cancer oaa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oaa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120638153  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     120638153   09163 Immune disease    05322 Systemic lupus erythematosus     120638153   09165 Substance dependence    05034 Alcoholism     120638153  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oaa03036]     120638153   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oaa04147]     120638153 Chromosome and associated proteins [BR:oaa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120638153 Exosome [BR:oaa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120638153 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  120638153 NCBI-ProteinID:  XP_039766718 UniProt:  F6QTF3 LinkDB All DBs Position X5:4108351..4108815 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcaaaccgcccgcaaatccaccggcggcaaggcgccccgcaagcag ctggccaccaaggcggcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac cgctaccggcccggcaccgtggcgctgcgggagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgcccttccagcggctggtgcgggagatcgcccaggacttcaag acggacctgcgcttccagagctcggccgtcatggccctgcaggaggccagcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgggtcaccatc atgcccaaggacatccagctggcccgccgcatccgcggagagagggcttaa

DBGET integrated database retrieval system