Oscillatoria acuminata: Oscil6304_3597 Help Entry Oscil6304_3597    CDS       T02368                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism oac  Oscillatoria acuminata Pathway oac01100   Metabolic pathways oac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:oac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Oscil6304_3597    00074 Mycolic acid biosynthesis     Oscil6304_3597   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Oscil6304_3597 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  AFY83160 UniProt:  K9TKU2 LinkDB All DBs Position 4529006..4529257 Genome browser AA seq 83 aa AA seqDB search MSQEDIFSQVKKIVTDQLEVEGDKVTPSASFAEDLGADSLDTVELVMALEEAFDIEIPDE AAEKITTVQEAVNYIESQVAAKA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagtcaagaagatattttttcccaagtcaagaaaatcgtcaccgatcaactggaagtt gaaggggataaagtcaccccttccgccagctttgccgaagatctcggcgctgattccctg gatacagtggaactggtgatggcattagaagaagcgtttgatattgaaattcctgacgaa gcagcagaaaaaatcaccaccgtccaagaggcagtgaactacatcgagagccaagttgca gcaaaagcataa

DBGET integrated database retrieval system