Oxynema acuminatum: Oscil6304_4128 Help Entry Oscil6304_4128    CDS       T02368                                  Name (GenBank) cytochrome b559, alpha subunit   KO K02707   photosystem II cytochrome b559 subunit alpha Organism oac  Oxynema acuminatum Pathway oac00195   Photosynthesis oac01100   Metabolic pathways Module oac_M00161   Photosystem II oac_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:oac00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     Oscil6304_4128  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:oac00194]     Oscil6304_4128 Photosynthesis proteins [BR:oac00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     Oscil6304_4128 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  AFY83657 UniProt:  K9TLB2 LinkDB All DBs Position 5253836..5254087 Genome browser AA seq 83 aa AA seqDB search MSTGSTGERPFSDIVTSIRYWVIHSITIPALFIAGWLFVSTGLAYDAFGTPRPNEYFSQE RLELPIVQDRFNAKDQIDDLIIK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtctacaggctcgactggagaacgtccgttttctgatattgttaccagcattcgctat tgggtgattcacagcatcaccattccggccttatttatcgccggttggctgtttgtgagc actgggttagcctacgatgcctttggcacccctcgtccgaacgaatatttcagccaagaa cgcttggaactgccgatcgttcaggatcgctttaatgcgaaagaccagattgacgacttg attattaagtaa

DBGET integrated database retrieval system