Brucella anthropi OAB: DR92_1712 Help Entry DR92_1712         CDS       T03251                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism oah  Brucella anthropi OAB Pathway oah02024   Quorum sensing oah03018   RNA degradation Brite KEGG Orthology (KO) [BR:oah00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DR92_1712 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DR92_1712 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:oah03019]     DR92_1712 (hfq)    03036 Chromosome and associated proteins [BR:oah03036]     DR92_1712 (hfq) Messenger RNA biogenesis [BR:oah03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DR92_1712 (hfq) Chromosome and associated proteins [BR:oah03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DR92_1712 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AIK44356 UniProt:  A0A011VB49 LinkDB All DBs Position 1:complement(1781723..1781959) Genome browser AA seq 78 aa AA seqDB search MAERSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFEGEEA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctgaacgatcgcaaaatctacaagacctttttctgaattctgtacgtaagcagaaa atttccctgacgatttttcttatcaatggcgtgaaactgaccggcattgtaacgtcgttt gataatttctgcgtgcttttgcgccgtgacggtcattcgcagcttgtctacaagcatgcg atttcgacgatcatgccaagccagcctgtgcagatgttcgaaggcgaagaagcctga

DBGET integrated database retrieval system