Brucella anthropi OAB: DR92_628 Help Entry DR92_628          CDS       T03251                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism oah  Brucella anthropi OAB Pathway oah00400   Phenylalanine, tyrosine and tryptophan biosynthesis oah01100   Metabolic pathways oah01110   Biosynthesis of secondary metabolites oah01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:oah00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     DR92_628 Enzymes [BR:oah01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      DR92_628 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  AIK43520 LinkDB All DBs Position 1:652214..652525 Genome browser AA seq 103 aa AA seqDB search MSDEQNTAPAELLALRASIDNIDAALIHMLAERFRCTKAVGVLKAERGLAPADPDREKRQ VERLRALATDAHLDPDFAEKFLNFIVKEVIRHHEHAAANHGGK NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgaacagaacactgcaccggctgaacttctggcactgcgcgcctccatcgac aatatcgatgctgcgctgatccacatgctggccgaacgttttcgctgtaccaaggctgtc ggtgtactcaaggccgaacgcggcctcgcaccggctgatccggaccgcgaaaaacgtcag gtggaacgtctgcgcgctctggcaaccgacgcccatctcgatcccgatttcgccgaaaaa ttcctgaacttcatcgtgaaggaagtcattcggcatcatgagcatgccgccgcaaaccac ggcggaaagtaa

DBGET integrated database retrieval system