Oleispira antarctica: OLEAN_C33120 Help Entry OLEAN_C33120      CDS       T04028                                  Symbol tatA Name (GenBank) Integral membrane protein TatA   KO K03116   sec-independent protein translocase protein TatA Organism oai  Oleispira antarctica Pathway oai03060   Protein export oai03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:oai00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     OLEAN_C33120 (tatA)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     OLEAN_C33120 (tatA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:oai02044]     OLEAN_C33120 (tatA) Secretion system [BR:oai02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    OLEAN_C33120 (tatA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF4834 Motif Other DBs NCBI-ProteinID:  CCK77488 UniProt:  R4YU27 LinkDB All DBs Position 3755957..3756229 Genome browser AA seq 90 aa AA seqDB search MLGGISIWQLLIVFVIVILVFGTKKLRNLGGDLGGAVKGFKNAISEDPKKAEEEKAAELQ QSLSLDEKDATFDGTAEKQTAEKQKDQDKK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgttaggtggtattagtatttggcagttattgatcgtattcgttatcgtaattttagtg ttcggaactaaaaaactacgtaatttgggtggcgatttaggcggcgcagttaaaggcttt aaaaatgccattagcgaagaccctaaaaaagcggaagaagaaaaagccgccgagcttcag caatcactttctcttgatgaaaaagatgcgacgtttgacggcactgctgaaaagcaaaca gctgaaaaacaaaaagaccaagacaagaaataa

DBGET integrated database retrieval system