Oxalobacter aliiformigenes: NB647_01275
Help
Entry
NB647_01275 CDS
T08749
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
oal
Oxalobacter aliiformigenes
Pathway
oal02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
oal00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
NB647_01275 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
oal02000
]
NB647_01275 (phnC)
Enzymes [BR:
oal01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
NB647_01275 (phnC)
Transporters [BR:
oal02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
NB647_01275 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
RsgA_GTPase
AAA_22
SMC_N
AAA_29
AAA_23
AAA_16
AAA_30
G-alpha
AAA_25
AAA_15
Motif
Other DBs
NCBI-ProteinID:
WAV89490
LinkDB
All DBs
Position
254858..255649
Genome browser
AA seq
263 aa
AA seq
DB search
MIQLENVSVRYEDTVALHPVSLGIHEGQFTVLLGSSGAGKSTFLRCLNLMHSRISGRVRV
SGFDGNWNRKALQKLRRETGMIFQQHQLIERQSALQNVLMGRFGYHSVLRSLFPLSEAEQ
KLGLQSLKRVGLLDKALCRVNQLSGGQQQRVGIARVLAQQPKTILADEPVASLDPATADE
VLELLHSICREDGISAVVSLHQVDLARKYADRIIGLAGGRVVFDGVPETLTEAGIEELYR
NRRSGTEASMADPLPNFSLPLAS
NT seq
792 nt
NT seq
+upstream
nt +downstream
nt
atgattcaattggaaaatgtcagtgtcagatatgaagatacggttgccttgcatccggtt
tctctcggaatccatgaaggacagtttaccgttctgctcggttcatccggtgcgggaaaa
tccacttttctaagatgccttaacctgatgcattcccgaattagcggtcgggtgcgtgtt
tccggtttcgatggaaactggaacagaaaagcactgcagaaacttcgtcgtgaaacaggg
atgattttccagcagcatcaattgatcgaaaggcaatcggcgcttcagaatgttttgatg
ggaaggttcgggtatcactctgttttgcgttctctgttcccgctatcggaggcagagcag
aaattggggctgcaaagcctgaaacgggtagggttgcttgacaaggcactgtgtcgggta
aaccagttgagtggcggccagcaacagcgggtcggtattgccagagtgcttgcgcaacaa
cccaaaaccattcttgcagatgaaccggttgcaagtcttgatcctgcaacagcggatgaa
gtgctggagttgctgcattctatttgtcgtgaagacggtatctccgcggttgtcagtctg
catcaggttgatctggcaaggaaatatgcagaccggattatcggtctggctggaggtcgc
gtcgtttttgacggtgttcccgaaacgttgaccgaagccggaattgaagagctttacagg
aacagacgttccggcacagaagcgtcaatggcggacccgttgccgaatttttcccttcca
ttagcgagttaa
DBGET
integrated database retrieval system