Oxalobacter aliiformigenes: NB647_03915 Help Entry NB647_03915       CDS       T08749                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism oal  Oxalobacter aliiformigenes Brite KEGG Orthology (KO) [BR:oal00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oal03036]     NB647_03915    03400 DNA repair and recombination proteins [BR:oal03400]     NB647_03915 Chromosome and associated proteins [BR:oal03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     NB647_03915 DNA repair and recombination proteins [BR:oal03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       NB647_03915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N TMF_DNA_bd Wtap Seryl_tRNA_N OGFOD2-like GlutR_dimer KELK AAA_13 HalX TSC22 DUF3573 Motif Other DBs NCBI-ProteinID:  WAV89949 LinkDB All DBs Position complement(830229..830519) Genome browser AA seq 96 aa AA seqDB search MATYKQLQDQIKQLQHEAEELRKNELSNAIAQIKMTMAEYGITLADLGFTNKKKNGQVRT PLAPKYRNPVTGETWSGRGKAPKWIDPNNREKFLIK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacttacaagcaattacaggatcagataaaacagcttcagcatgaagcggaagaa ctccgcaaaaacgaattatccaatgccattgcacaaatcaagatgaccatggccgaatac ggcattaccctggccgatctcggttttaccaacaaaaagaaaaacggccaagtccgtacc ccactggctccgaaataccggaatccggtaacgggtgaaacctggtccggccgcggcaag gcaccgaaatggatcgatccgaacaacagggaaaaatttctcatcaaataa

DBGET integrated database retrieval system