Ovis aries (sheep): 100145880 Help Entry 100145880         CDS       T03117                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism oas  Ovis aries (sheep) Pathway oas04137   Mitophagy - animal oas04140   Autophagy - animal oas04144   Endocytosis oas04145   Phagosome oas04148   Efferocytosis oas05132   Salmonella infection oas05146   Amoebiasis oas05152   Tuberculosis Brite KEGG Orthology (KO) [BR:oas00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100145880 (RAB7A)    04145 Phagosome     100145880 (RAB7A)    04140 Autophagy - animal     100145880 (RAB7A)    04137 Mitophagy - animal     100145880 (RAB7A)    04148 Efferocytosis     100145880 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100145880 (RAB7A)    05152 Tuberculosis     100145880 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100145880 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     100145880 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     100145880 (RAB7A)    04031 GTP-binding proteins [BR:oas04031]     100145880 (RAB7A) Membrane trafficking [BR:oas04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     100145880 (RAB7A) Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100145880 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    100145880 (RAB7A)   Exosomal proteins of colorectal cancer cells    100145880 (RAB7A)   Exosomal proteins of bladder cancer cells    100145880 (RAB7A) GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     100145880 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  100145880 NCBI-ProteinID:  NP_001119836 UniProt:  B2LYK6 A0A6P3CX02 LinkDB All DBs Position 19:complement(59078985..59124301) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRPKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcgaggaagaaagtgctgctgaaggtgatcatcctgggagactctggagtcggg aagacctcgctcatgaaccagtacgtgaacaagaagttcagtaaccagtacaaagccacg ataggcgcggacttcctgacgaaggaggtgatggtggacgacaggctcgtgaccatgcag atctgggacacggcgggacaggagcggttccagtccctgggcgtggccttctacagaggc gccgactgctgtgtcctggtgttcgacgtgaccgcccccaacacgttcaagacccttgac agctggagagacgagtttctcatccaggccagtccccgggaccccgagaacttccccttc gtcgtgctgggaaacaagattgacctcgaaaacagacaggtggccaccaagcgggctcag gcctggtgctacagcaaaaacaacatcccctactttgagaccagcgccaaggaggccatc aacgtggagcaggccttccagacgatcgcccggaacgcgctcaagcaggaaacggaagtg gagctgtacaacgagttccccgagcccatcaaactggacaagaacgaccgccccaaggcc tcggccgagagctgcagctgctga

DBGET integrated database retrieval system