Ovis aries (sheep): 100216433 Help Entry 100216433         CDS       T03117                                  Symbol CDK2 Name (RefSeq) cyclin-dependent kinase 2   KO K02206   cyclin-dependent kinase 2 [EC:2.7.11.22] Organism oas  Ovis aries (sheep) Pathway oas04068   FoxO signaling pathway oas04110   Cell cycle oas04114   Oocyte meiosis oas04115   p53 signaling pathway oas04151   PI3K-Akt signaling pathway oas04218   Cellular senescence oas04914   Progesterone-mediated oocyte maturation oas04934   Cushing syndrome oas05160   Hepatitis C oas05161   Hepatitis B oas05162   Measles oas05165   Human papillomavirus infection oas05166   Human T-cell leukemia virus 1 infection oas05169   Epstein-Barr virus infection oas05200   Pathways in cancer oas05203   Viral carcinogenesis oas05215   Prostate cancer oas05222   Small cell lung cancer oas05226   Gastric cancer Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100216433 (CDK2)    04151 PI3K-Akt signaling pathway     100216433 (CDK2)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100216433 (CDK2)    04114 Oocyte meiosis     100216433 (CDK2)    04115 p53 signaling pathway     100216433 (CDK2)    04218 Cellular senescence     100216433 (CDK2)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     100216433 (CDK2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100216433 (CDK2)    05203 Viral carcinogenesis     100216433 (CDK2)   09162 Cancer: specific types    05226 Gastric cancer     100216433 (CDK2)    05215 Prostate cancer     100216433 (CDK2)    05222 Small cell lung cancer     100216433 (CDK2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100216433 (CDK2)    05161 Hepatitis B     100216433 (CDK2)    05160 Hepatitis C     100216433 (CDK2)    05162 Measles     100216433 (CDK2)    05169 Epstein-Barr virus infection     100216433 (CDK2)    05165 Human papillomavirus infection     100216433 (CDK2)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100216433 (CDK2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:oas01001]     100216433 (CDK2)   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:oas03032]     100216433 (CDK2)    03036 Chromosome and associated proteins [BR:oas03036]     100216433 (CDK2) Enzymes [BR:oas01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100216433 (CDK2) Protein kinases [BR:oas01001]  Serine/threonine kinases: CMGC group   CDK family    100216433 (CDK2) DNA replication proteins [BR:oas03032]  Eukaryotic type   DNA Replication Initiation Factors    CDK (cyclin dependent kinase)     100216433 (CDK2) Chromosome and associated proteins [BR:oas03036]  Eukaryotic type   Centrosome formation proteins    Kinases and associated factors     100216433 (CDK2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Haspin_kinase APH Motif Other DBs NCBI-GeneID:  100216433 NCBI-ProteinID:  NP_001135981 UniProt:  B7U171 A0A6P9FQI2 LinkDB All DBs Position 3:complement(163554031..163559605) Genome browser AA seq 298 aa AA seqDB search MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS HRVLHRDLKPQNLLINADGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL NT seq 897 nt NT seq  +upstreamnt  +downstreamnt atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa gccaaaaacaagttgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag acagagggtgtacccagtactgccatacgagagatctctctgcttaaggagcttaatcac cctaatattgtcaagctgctggatgtcattcacacagaaaacaaactctaccttgttttt gagtttctgcaccaggatctcaagaaattcatggatgcctctgcactcactggcattcct cttccgctcataaagagctacttgttccagctgctccagggcctagctttctgccactct catcgggtcctgcaccgagaccttaaacctcagaatctgcttatcaacgcagatgggtcc atcaagctagcagacttcggactagccagagcttttggggtccctgttcgtacttatacc cacgaggtggtgactctgtggtaccgagcaccggaaatccttctgggctgcaaatactac tccacagcagtggacatatggagcctcggttgcatctttgctgagatggtgacccgccgg gccctattccctggagattctgagatcgaccagctcttccggatctttcggaccctggga accccagatgaggtggtttggccaggagttacttctatgcctgattataagccaagtttc cccaagtgggccaggcaggattttagcaaagtggtgcctcccctggatgaagatggacgg agcttgttatcgcaaatgctgcactacgaccctaacaagcggatttcagccaaggcagct ctggctcaccccttcttccaagatgtgaccaagccagtacctcaccttcgactctga

DBGET integrated database retrieval system