Ovis aries (sheep): 100216435 Help Entry 100216435         CDS       T03117                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism oas  Ovis aries (sheep) Pathway oas03008   Ribosome biogenesis in eukaryotes oas03083   Polycomb repressive complex oas04064   NF-kappa B signaling pathway oas04137   Mitophagy - animal oas04310   Wnt signaling pathway oas04520   Adherens junction oas05010   Alzheimer disease oas05020   Prion disease oas05022   Pathways of neurodegeneration - multiple diseases oas05162   Measles oas05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:oas00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     100216435 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     100216435 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100216435 (CSNK2B)    04064 NF-kappa B signaling pathway     100216435 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100216435 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     100216435 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100216435 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     100216435 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     100216435 (CSNK2B)    05020 Prion disease     100216435 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     100216435 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:oas03009]     100216435 (CSNK2B)    03036 Chromosome and associated proteins [BR:oas03036]     100216435 (CSNK2B) Ribosome biogenesis [BR:oas03009]  Eukaryotic type   90S particles    Kinase     100216435 (CSNK2B) Chromosome and associated proteins [BR:oas03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      100216435 (CSNK2B) SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  100216435 NCBI-ProteinID:  NP_001135983 UniProt:  B7U170 LinkDB All DBs Position 20:complement(26712255..26716041) Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcttggttctgtgggctccgtggcaatgaa ttcttctgtgaggtggatgaagactatatccaggacaaattcaatctcactggactcaat gaacaggtgcctcactatcgacaagctttagacatgatcttggacctggagcctgatgag gagctggaagacaaccccaaccagagtgacctgattgagcaagcagccgaaatgctctat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggatactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcagacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccaccacacggatggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagaggcccgcc aaccagtttgtgcccaggctttacggtttcaagatccatccaatggcttaccagctgcag ctccaagccgccagcaacttcaagagcccagtgaagacgattcgctga

DBGET integrated database retrieval system