Ovis aries (sheep): 100302078 Help Entry 100302078         CDS       T03117                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism oas  Ovis aries (sheep) Pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04022   cGMP-PKG signaling pathway oas04024   cAMP signaling pathway oas04062   Chemokine signaling pathway oas04071   Sphingolipid signaling pathway oas04072   Phospholipase D signaling pathway oas04081   Hormone signaling oas04144   Endocytosis oas04150   mTOR signaling pathway oas04270   Vascular smooth muscle contraction oas04310   Wnt signaling pathway oas04350   TGF-beta signaling pathway oas04360   Axon guidance oas04510   Focal adhesion oas04520   Adherens junction oas04530   Tight junction oas04611   Platelet activation oas04621   NOD-like receptor signaling pathway oas04625   C-type lectin receptor signaling pathway oas04660   T cell receptor signaling pathway oas04670   Leukocyte transendothelial migration oas04722   Neurotrophin signaling pathway oas04810   Regulation of actin cytoskeleton oas04921   Oxytocin signaling pathway oas04928   Parathyroid hormone synthesis, secretion and action oas04972   Pancreatic secretion oas05100   Bacterial invasion of epithelial cells oas05132   Salmonella infection oas05133   Pertussis oas05135   Yersinia infection oas05152   Tuberculosis oas05163   Human cytomegalovirus infection oas05200   Pathways in cancer oas05203   Viral carcinogenesis oas05205   Proteoglycans in cancer oas05206   MicroRNAs in cancer oas05210   Colorectal cancer oas05417   Lipid and atherosclerosis oas05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100302078 (RHOA)    04015 Rap1 signaling pathway     100302078 (RHOA)    04310 Wnt signaling pathway     100302078 (RHOA)    04350 TGF-beta signaling pathway     100302078 (RHOA)    04072 Phospholipase D signaling pathway     100302078 (RHOA)    04071 Sphingolipid signaling pathway     100302078 (RHOA)    04024 cAMP signaling pathway     100302078 (RHOA)    04022 cGMP-PKG signaling pathway     100302078 (RHOA)    04150 mTOR signaling pathway     100302078 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     100302078 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100302078 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100302078 (RHOA)    04520 Adherens junction     100302078 (RHOA)    04530 Tight junction     100302078 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100302078 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100302078 (RHOA)    04621 NOD-like receptor signaling pathway     100302078 (RHOA)    04625 C-type lectin receptor signaling pathway     100302078 (RHOA)    04660 T cell receptor signaling pathway     100302078 (RHOA)    04670 Leukocyte transendothelial migration     100302078 (RHOA)    04062 Chemokine signaling pathway     100302078 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     100302078 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     100302078 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     100302078 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     100302078 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100302078 (RHOA)   09158 Development and regeneration    04360 Axon guidance     100302078 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100302078 (RHOA)    05206 MicroRNAs in cancer     100302078 (RHOA)    05205 Proteoglycans in cancer     100302078 (RHOA)    05203 Viral carcinogenesis     100302078 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     100302078 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100302078 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100302078 (RHOA)    05135 Yersinia infection     100302078 (RHOA)    05133 Pertussis     100302078 (RHOA)    05152 Tuberculosis     100302078 (RHOA)    05100 Bacterial invasion of epithelial cells     100302078 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100302078 (RHOA)    05418 Fluid shear stress and atherosclerosis     100302078 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     100302078 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     100302078 (RHOA)    04031 GTP-binding proteins [BR:oas04031]     100302078 (RHOA) Membrane trafficking [BR:oas04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100302078 (RHOA) Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100302078 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    100302078 (RHOA)   Exosomal proteins of colorectal cancer cells    100302078 (RHOA)   Exosomal proteins of bladder cancer cells    100302078 (RHOA) GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100302078 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  100302078 NCBI-ProteinID:  NP_001155347 UniProt:  C5IJ99 A0A6P9FQL7 LinkDB All DBs Position 19:50749367..50799711 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system