Ovis aries (sheep): 100302084 Help Entry 100302084         CDS       T03117                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism oas  Ovis aries (sheep) Pathway oas04014   Ras signaling pathway oas04137   Mitophagy - animal oas04144   Endocytosis oas04145   Phagosome oas04148   Efferocytosis oas04962   Vasopressin-regulated water reabsorption oas05014   Amyotrophic lateral sclerosis oas05022   Pathways of neurodegeneration - multiple diseases oas05132   Salmonella infection oas05146   Amoebiasis oas05152   Tuberculosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100302084 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100302084 (RAB5A)    04145 Phagosome     100302084 (RAB5A)    04137 Mitophagy - animal     100302084 (RAB5A)    04148 Efferocytosis     100302084 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100302084 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100302084 (RAB5A)    05152 Tuberculosis     100302084 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100302084 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100302084 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     100302084 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     100302084 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     100302084 (RAB5A)    04031 GTP-binding proteins [BR:oas04031]     100302084 (RAB5A) Membrane trafficking [BR:oas04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100302084 (RAB5A)  Endosome - Lysosome transport     100302084 (RAB5A) Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100302084 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    100302084 (RAB5A)   Exosomal proteins of colorectal cancer cells    100302084 (RAB5A)   Exosomal proteins of bladder cancer cells    100302084 (RAB5A) GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100302084 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 BrnT_toxin MCR_beta Motif Other DBs NCBI-GeneID:  100302084 NCBI-ProteinID:  NP_001155353 UniProt:  C5IJ98 LinkDB All DBs Position 1:278208719..278242018 Genome browser AA seq 215 aa AA seqDB search MANRGAARPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGAIPPRGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcagcaagacccaacgggccaaacactgggaataagatctgccag tttaaactggtgcttctgggggagtctgctgttggcaagtcgagccttgtgcttcgtttc gtaaagggccagtttcatgaatttcaggagagtaccatcggggctgcttttctaactcaa acagtgtgtcttgatgacacgacggtaaagtttgaaatatgggacacggctggccaagaa cggtaccacagcctggcgcccatgtattacagaggcgcccaggccgccatagtcgtgtac gatatcacgaacgaggagtcctttgccagagccaaaaactgggttaaagagcttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggccgacctggcaaataaa agagctgtcgacttccaggaggcacagtcctatgcggatgataacagtttattatttatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaagaag ttgccgaagaacgaaccacagaatccaggagcaattcccccccgaggaagaggagtcgac ctcactgagcccacacagcccaccaggagtcagtgctgcagcaactga

DBGET integrated database retrieval system