Ovis aries (sheep): 101102438 Help Entry 101102438         CDS       T03117                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism oas  Ovis aries (sheep) Pathway oas01521   EGFR tyrosine kinase inhibitor resistance oas01522   Endocrine resistance oas04010   MAPK signaling pathway oas04012   ErbB signaling pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04062   Chemokine signaling pathway oas04068   FoxO signaling pathway oas04071   Sphingolipid signaling pathway oas04072   Phospholipase D signaling pathway oas04137   Mitophagy - animal oas04140   Autophagy - animal oas04150   mTOR signaling pathway oas04151   PI3K-Akt signaling pathway oas04210   Apoptosis oas04211   Longevity regulating pathway oas04213   Longevity regulating pathway - multiple species oas04218   Cellular senescence oas04360   Axon guidance oas04370   VEGF signaling pathway oas04371   Apelin signaling pathway oas04540   Gap junction oas04550   Signaling pathways regulating pluripotency of stem cells oas04625   C-type lectin receptor signaling pathway oas04650   Natural killer cell mediated cytotoxicity oas04660   T cell receptor signaling pathway oas04662   B cell receptor signaling pathway oas04664   Fc epsilon RI signaling pathway oas04714   Thermogenesis oas04720   Long-term potentiation oas04722   Neurotrophin signaling pathway oas04725   Cholinergic synapse oas04726   Serotonergic synapse oas04730   Long-term depression oas04810   Regulation of actin cytoskeleton oas04910   Insulin signaling pathway oas04912   GnRH signaling pathway oas04915   Estrogen signaling pathway oas04916   Melanogenesis oas04917   Prolactin signaling pathway oas04919   Thyroid hormone signaling pathway oas04921   Oxytocin signaling pathway oas04926   Relaxin signaling pathway oas04929   GnRH secretion oas04933   AGE-RAGE signaling pathway in diabetic complications oas04935   Growth hormone synthesis, secretion and action oas05010   Alzheimer disease oas05022   Pathways of neurodegeneration - multiple diseases oas05034   Alcoholism oas05160   Hepatitis C oas05161   Hepatitis B oas05163   Human cytomegalovirus infection oas05165   Human papillomavirus infection oas05166   Human T-cell leukemia virus 1 infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05170   Human immunodeficiency virus 1 infection oas05200   Pathways in cancer oas05203   Viral carcinogenesis oas05205   Proteoglycans in cancer oas05206   MicroRNAs in cancer oas05207   Chemical carcinogenesis - receptor activation oas05208   Chemical carcinogenesis - reactive oxygen species oas05210   Colorectal cancer oas05211   Renal cell carcinoma oas05213   Endometrial cancer oas05214   Glioma oas05215   Prostate cancer oas05216   Thyroid cancer oas05218   Melanoma oas05219   Bladder cancer oas05220   Chronic myeloid leukemia oas05221   Acute myeloid leukemia oas05223   Non-small cell lung cancer oas05224   Breast cancer oas05225   Hepatocellular carcinoma oas05226   Gastric cancer oas05230   Central carbon metabolism in cancer oas05231   Choline metabolism in cancer oas05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oas05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101102438 (NRAS)    04012 ErbB signaling pathway     101102438 (NRAS)    04014 Ras signaling pathway     101102438 (NRAS)    04015 Rap1 signaling pathway     101102438 (NRAS)    04370 VEGF signaling pathway     101102438 (NRAS)    04371 Apelin signaling pathway     101102438 (NRAS)    04068 FoxO signaling pathway     101102438 (NRAS)    04072 Phospholipase D signaling pathway     101102438 (NRAS)    04071 Sphingolipid signaling pathway     101102438 (NRAS)    04151 PI3K-Akt signaling pathway     101102438 (NRAS)    04150 mTOR signaling pathway     101102438 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101102438 (NRAS)    04137 Mitophagy - animal     101102438 (NRAS)   09143 Cell growth and death    04210 Apoptosis     101102438 (NRAS)    04218 Cellular senescence     101102438 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     101102438 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     101102438 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101102438 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101102438 (NRAS)    04650 Natural killer cell mediated cytotoxicity     101102438 (NRAS)    04660 T cell receptor signaling pathway     101102438 (NRAS)    04662 B cell receptor signaling pathway     101102438 (NRAS)    04664 Fc epsilon RI signaling pathway     101102438 (NRAS)    04062 Chemokine signaling pathway     101102438 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101102438 (NRAS)    04929 GnRH secretion     101102438 (NRAS)    04912 GnRH signaling pathway     101102438 (NRAS)    04915 Estrogen signaling pathway     101102438 (NRAS)    04917 Prolactin signaling pathway     101102438 (NRAS)    04921 Oxytocin signaling pathway     101102438 (NRAS)    04926 Relaxin signaling pathway     101102438 (NRAS)    04935 Growth hormone synthesis, secretion and action     101102438 (NRAS)    04919 Thyroid hormone signaling pathway     101102438 (NRAS)    04916 Melanogenesis     101102438 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     101102438 (NRAS)    04726 Serotonergic synapse     101102438 (NRAS)    04720 Long-term potentiation     101102438 (NRAS)    04730 Long-term depression     101102438 (NRAS)    04722 Neurotrophin signaling pathway     101102438 (NRAS)   09158 Development and regeneration    04360 Axon guidance     101102438 (NRAS)   09149 Aging    04211 Longevity regulating pathway     101102438 (NRAS)    04213 Longevity regulating pathway - multiple species     101102438 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     101102438 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101102438 (NRAS)    05206 MicroRNAs in cancer     101102438 (NRAS)    05205 Proteoglycans in cancer     101102438 (NRAS)    05207 Chemical carcinogenesis - receptor activation     101102438 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     101102438 (NRAS)    05203 Viral carcinogenesis     101102438 (NRAS)    05230 Central carbon metabolism in cancer     101102438 (NRAS)    05231 Choline metabolism in cancer     101102438 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101102438 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     101102438 (NRAS)    05225 Hepatocellular carcinoma     101102438 (NRAS)    05226 Gastric cancer     101102438 (NRAS)    05214 Glioma     101102438 (NRAS)    05216 Thyroid cancer     101102438 (NRAS)    05221 Acute myeloid leukemia     101102438 (NRAS)    05220 Chronic myeloid leukemia     101102438 (NRAS)    05218 Melanoma     101102438 (NRAS)    05211 Renal cell carcinoma     101102438 (NRAS)    05219 Bladder cancer     101102438 (NRAS)    05215 Prostate cancer     101102438 (NRAS)    05213 Endometrial cancer     101102438 (NRAS)    05224 Breast cancer     101102438 (NRAS)    05223 Non-small cell lung cancer     101102438 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101102438 (NRAS)    05170 Human immunodeficiency virus 1 infection     101102438 (NRAS)    05161 Hepatitis B     101102438 (NRAS)    05160 Hepatitis C     101102438 (NRAS)    05163 Human cytomegalovirus infection     101102438 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     101102438 (NRAS)    05165 Human papillomavirus infection     101102438 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101102438 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     101102438 (NRAS)   09165 Substance dependence    05034 Alcoholism     101102438 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101102438 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101102438 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101102438 (NRAS)    01522 Endocrine resistance     101102438 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     101102438 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     101102438 (NRAS)    04031 GTP-binding proteins [BR:oas04031]     101102438 (NRAS) Membrane trafficking [BR:oas04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101102438 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     101102438 (NRAS) Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101102438 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    101102438 (NRAS)   Exosomal proteins of breast cancer cells    101102438 (NRAS)   Exosomal proteins of colorectal cancer cells    101102438 (NRAS) GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101102438 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  101102438 NCBI-ProteinID:  XP_004002408 UniProt:  W5QFK5 LinkDB All DBs Position 1:complement(92089068..92098832) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgacttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaaaagctatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggcactcaaggt tgtatggggttgccatgtgtggtaatgtaa

DBGET integrated database retrieval system