Ovis aries (sheep): 101105840 Help Entry 101105840         CDS       T03117                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism oas  Ovis aries (sheep) Pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04020   Calcium signaling pathway oas04022   cGMP-PKG signaling pathway oas04024   cAMP signaling pathway oas04070   Phosphatidylinositol signaling system oas04114   Oocyte meiosis oas04218   Cellular senescence oas04261   Adrenergic signaling in cardiomyocytes oas04270   Vascular smooth muscle contraction oas04371   Apelin signaling pathway oas04625   C-type lectin receptor signaling pathway oas04713   Circadian entrainment oas04720   Long-term potentiation oas04722   Neurotrophin signaling pathway oas04728   Dopaminergic synapse oas04740   Olfactory transduction oas04744   Phototransduction oas04750   Inflammatory mediator regulation of TRP channels oas04910   Insulin signaling pathway oas04912   GnRH signaling pathway oas04915   Estrogen signaling pathway oas04916   Melanogenesis oas04921   Oxytocin signaling pathway oas04922   Glucagon signaling pathway oas04924   Renin secretion oas04925   Aldosterone synthesis and secretion oas04970   Salivary secretion oas04971   Gastric acid secretion oas05010   Alzheimer disease oas05012   Parkinson disease oas05022   Pathways of neurodegeneration - multiple diseases oas05031   Amphetamine addiction oas05034   Alcoholism oas05133   Pertussis oas05152   Tuberculosis oas05163   Human cytomegalovirus infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05170   Human immunodeficiency virus 1 infection oas05200   Pathways in cancer oas05214   Glioma oas05417   Lipid and atherosclerosis oas05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101105840    04015 Rap1 signaling pathway     101105840    04371 Apelin signaling pathway     101105840    04020 Calcium signaling pathway     101105840    04070 Phosphatidylinositol signaling system     101105840    04024 cAMP signaling pathway     101105840    04022 cGMP-PKG signaling pathway     101105840  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101105840    04218 Cellular senescence     101105840  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101105840   09152 Endocrine system    04910 Insulin signaling pathway     101105840    04922 Glucagon signaling pathway     101105840    04912 GnRH signaling pathway     101105840    04915 Estrogen signaling pathway     101105840    04921 Oxytocin signaling pathway     101105840    04916 Melanogenesis     101105840    04924 Renin secretion     101105840    04925 Aldosterone synthesis and secretion     101105840   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101105840    04270 Vascular smooth muscle contraction     101105840   09154 Digestive system    04970 Salivary secretion     101105840    04971 Gastric acid secretion     101105840   09156 Nervous system    04728 Dopaminergic synapse     101105840    04720 Long-term potentiation     101105840    04722 Neurotrophin signaling pathway     101105840   09157 Sensory system    04744 Phototransduction     101105840    04740 Olfactory transduction     101105840    04750 Inflammatory mediator regulation of TRP channels     101105840   09159 Environmental adaptation    04713 Circadian entrainment     101105840  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101105840   09162 Cancer: specific types    05214 Glioma     101105840   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101105840    05163 Human cytomegalovirus infection     101105840    05167 Kaposi sarcoma-associated herpesvirus infection     101105840   09171 Infectious disease: bacterial    05133 Pertussis     101105840    05152 Tuberculosis     101105840   09164 Neurodegenerative disease    05010 Alzheimer disease     101105840    05012 Parkinson disease     101105840    05022 Pathways of neurodegeneration - multiple diseases     101105840   09165 Substance dependence    05031 Amphetamine addiction     101105840    05034 Alcoholism     101105840   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101105840    05418 Fluid shear stress and atherosclerosis     101105840  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oas01009]     101105840   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     101105840    03036 Chromosome and associated proteins [BR:oas03036]     101105840   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     101105840 Protein phosphatases and associated proteins [BR:oas01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101105840 Membrane trafficking [BR:oas04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     101105840 Chromosome and associated proteins [BR:oas03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      101105840 Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101105840 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH SPARC_Ca_bdg EF_EFCAB10_C SAPC2_N DUF5580_M EF-hand_EFHB_C EF-hand_STIM1 CFAP251_C FCaBP_EF-hand EF-hand_11 DUF8698 BamM_C MTIP_N ODF2_N SPEF2_C RSA-1_C SurA_N_3 ExbD Dockerin_1 PPFR1_M MmeI_hel Motif Other DBs NCBI-GeneID:  101105840 NCBI-ProteinID:  XP_004014360 UniProt:  A0ACI6Q7Q4 LinkDB All DBs Position 13:42705443..42706271 Genome browser AA seq 149 aa AA seqDB search MAEKLSEEQVAEFKEAFDKFDKDKDGTISVQELGTVMQEVGLKPSEAELKVLIARLDTDN NGIISFQEFLEAMAAGLQTSDTEEDLREIFRAFDQDNDGYISVDELRQATAQLGEKLSQD ELDAMIREADVDQDGRVNYEEFVRILTQN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaagctgtctgaagagcaggtggcggagttcaaggaggccttcgacaagttc gacaaggacaaggatggcaccatcagtgtgcaggagctgggcaccgtgatgcaggaggtg ggcctgaagccatcagaggctgagctgaaggtgctcatcgcccggctggacacggacaac aacggcatcatcagcttccaggagttcctggaggccatggccgcagggcttcagacctca gacacagaggaggacctgagggaaatcttccgtgccttcgaccaggacaacgatggctac atcagcgtggacgagctcaggcaggccacagcccagctgggggagaagctgtctcaggac gagctggatgccatgatccgggaggcagacgtggaccaagatggccgggtgaactatgag gagttcgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system