Ovis aries (sheep): 101106246 Help Entry 101106246         CDS       T03117                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism oas  Ovis aries (sheep) Pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04022   cGMP-PKG signaling pathway oas04024   cAMP signaling pathway oas04062   Chemokine signaling pathway oas04071   Sphingolipid signaling pathway oas04072   Phospholipase D signaling pathway oas04144   Endocytosis oas04150   mTOR signaling pathway oas04270   Vascular smooth muscle contraction oas04310   Wnt signaling pathway oas04350   TGF-beta signaling pathway oas04360   Axon guidance oas04510   Focal adhesion oas04520   Adherens junction oas04530   Tight junction oas04611   Platelet activation oas04621   NOD-like receptor signaling pathway oas04625   C-type lectin receptor signaling pathway oas04660   T cell receptor signaling pathway oas04670   Leukocyte transendothelial migration oas04722   Neurotrophin signaling pathway oas04810   Regulation of actin cytoskeleton oas04921   Oxytocin signaling pathway oas04928   Parathyroid hormone synthesis, secretion and action oas04972   Pancreatic secretion oas05100   Bacterial invasion of epithelial cells oas05132   Salmonella infection oas05133   Pertussis oas05135   Yersinia infection oas05152   Tuberculosis oas05163   Human cytomegalovirus infection oas05200   Pathways in cancer oas05203   Viral carcinogenesis oas05205   Proteoglycans in cancer oas05206   MicroRNAs in cancer oas05210   Colorectal cancer oas05417   Lipid and atherosclerosis oas05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101106246    04015 Rap1 signaling pathway     101106246    04310 Wnt signaling pathway     101106246    04350 TGF-beta signaling pathway     101106246    04072 Phospholipase D signaling pathway     101106246    04071 Sphingolipid signaling pathway     101106246    04024 cAMP signaling pathway     101106246    04022 cGMP-PKG signaling pathway     101106246    04150 mTOR signaling pathway     101106246  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101106246   09144 Cellular community - eukaryotes    04510 Focal adhesion     101106246    04520 Adherens junction     101106246    04530 Tight junction     101106246   09142 Cell motility    04810 Regulation of actin cytoskeleton     101106246  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101106246    04621 NOD-like receptor signaling pathway     101106246    04625 C-type lectin receptor signaling pathway     101106246    04660 T cell receptor signaling pathway     101106246    04670 Leukocyte transendothelial migration     101106246    04062 Chemokine signaling pathway     101106246   09152 Endocrine system    04921 Oxytocin signaling pathway     101106246    04928 Parathyroid hormone synthesis, secretion and action     101106246   09153 Circulatory system    04270 Vascular smooth muscle contraction     101106246   09154 Digestive system    04972 Pancreatic secretion     101106246   09156 Nervous system    04722 Neurotrophin signaling pathway     101106246   09158 Development and regeneration    04360 Axon guidance     101106246  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101106246    05206 MicroRNAs in cancer     101106246    05205 Proteoglycans in cancer     101106246    05203 Viral carcinogenesis     101106246   09162 Cancer: specific types    05210 Colorectal cancer     101106246   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101106246   09171 Infectious disease: bacterial    05132 Salmonella infection     101106246    05135 Yersinia infection     101106246    05133 Pertussis     101106246    05152 Tuberculosis     101106246    05100 Bacterial invasion of epithelial cells     101106246   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101106246    05418 Fluid shear stress and atherosclerosis     101106246  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     101106246   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     101106246    04031 GTP-binding proteins [BR:oas04031]     101106246 Membrane trafficking [BR:oas04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     101106246 Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101106246   Exosomal proteins of other body fluids (saliva and urine)    101106246   Exosomal proteins of colorectal cancer cells    101106246   Exosomal proteins of bladder cancer cells    101106246 GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     101106246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  101106246 NCBI-ProteinID:  XP_014949930 EnsemblRapid:  ENSOARG00020005077 UniProt:  W5Q4M2 LinkDB All DBs Position 3:complement(92495335..92496678) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPNTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNMPIMLVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRTALQ ARCGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagctggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccgaataccgacgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtcccaacatgcccatcatgctggttgggaacaagaaggat cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagaactgctctgcaa gccagatgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system